CABS-dock: ced3361bee8f984

Project name: ced3361bee8f984

Status: done

submitted: 2026-07-01 10:14:50, status changed: 2026-07-01 13:13:09

Project settings

Protein sequence(s)	LATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKK input pdb
Peptide sequence	DGYFLV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.7042	4.2358	23.2774	147
cluster_2.pdb ( medoid)	31.3525	7.17646	26.6441	225
cluster_3.pdb ( medoid)	29.4637	4.81949	27.3391	142
cluster_4.pdb ( medoid)	29.3712	6.06037	28.3787	178
cluster_5.pdb ( medoid)	20.9767	6.00667	36.093	126
cluster_6.pdb ( medoid)	5.57396	8.79088	22.3343	49
cluster_7.pdb ( medoid)	4.38255	8.89892	24.8527	39
cluster_8.pdb ( medoid)	3.20039	10.6237	23.8035	34
cluster_9.pdb ( medoid)	1.88002	18.0849	40.3716	34
cluster_10.pdb ( medoid)	1.52935	17.0007	35.7618	26