CABS-dock: d3ef89163af6404

Project name: d3ef89163af6404

Status: done

submitted: 2026-03-15 11:16:06, status changed: 2026-03-15 15:49:50

Project settings

Protein sequence(s)	QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVT input pdb
Peptide sequence	ETRLLAESF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.5962	7.50086	27.4878	252
cluster_2.pdb ( medoid)	25.7431	5.78795	20.6842	149
cluster_3.pdb ( medoid)	17.5661	11.6133	32.5646	204
cluster_4.pdb ( medoid)	8.71694	11.5866	32.2799	101
cluster_5.pdb ( medoid)	6.66458	10.6533	32.2756	71
cluster_6.pdb ( medoid)	5.47352	12.2408	30.5246	67
cluster_7.pdb ( medoid)	5.31619	11.8506	31.6794	63
cluster_8.pdb ( medoid)	3.18169	12.2576	28.7478	39
cluster_9.pdb ( medoid)	2.65183	9.80456	21.6171	26
cluster_10.pdb ( medoid)	2.46811	11.3447	36.1584	28