CABS-dock: d615955513f8f3b

Project name: d615955513f8f3b

Status: done

submitted: 2026-07-09 04:55:56, status changed: 2026-07-09 09:07:46

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	SDSYGGFDHDFSTRF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.9995	7.71447	36.4772	162
cluster_2.pdb ( medoid)	16.4353	3.95491	16.9623	65
cluster_3.pdb ( medoid)	15.3848	8.9049	27.0758	137
cluster_4.pdb ( medoid)	14.4144	7.42312	32.1668	107
cluster_5.pdb ( medoid)	13.1449	9.81371	38.3016	129
cluster_6.pdb ( medoid)	11.7559	13.1849	44.6938	155
cluster_7.pdb ( medoid)	10.6801	5.33702	32.4092	57
cluster_8.pdb ( medoid)	8.14794	7.11837	43.8873	58
cluster_9.pdb ( medoid)	7.84998	10.1911	41.9886	80
cluster_10.pdb ( medoid)	2.66076	18.7916	52.4954	50