Project name: d615955513f8f3b

Status: done

submitted: 2026-07-09 04:55:56, status changed: 2026-07-09 09:07:46

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence SDSYGGFDHDFSTRF
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.9995 7.71447 36.4772 162
cluster_2.pdb ( medoid) 16.4353 3.95491 16.9623 65
cluster_3.pdb ( medoid) 15.3848 8.9049 27.0758 137
cluster_4.pdb ( medoid) 14.4144 7.42312 32.1668 107
cluster_5.pdb ( medoid) 13.1449 9.81371 38.3016 129
cluster_6.pdb ( medoid) 11.7559 13.1849 44.6938 155
cluster_7.pdb ( medoid) 10.6801 5.33702 32.4092 57
cluster_8.pdb ( medoid) 8.14794 7.11837 43.8873 58
cluster_9.pdb ( medoid) 7.84998 10.1911 41.9886 80
cluster_10.pdb ( medoid) 2.66076 18.7916 52.4954 50