CABS-dock: p22CC

Project name: p22CC

Status: done

submitted: 2025-12-22 15:13:30, status changed: 2025-12-23 02:42:06

Project settings

Protein sequence(s)	SKHRIEPVCLIIRGSPGTGKSLATGIIARAIADKYHSSVYSLPPDPDHFDGYKQQVVTVMDDLCQNPDGKDMSLFCQMVSTVDFIPPMASLEEKGVSFTSKFVIASTNASNIIVPTVSDSDAIRRRFYMDCDIEVTDSYKTELGRLDAGRAAKLCSENNTANFKRCSPLVCGKAIQLRDRKSKVRYSVDTVVSELIREYNSRSAIGNTIEALFQ input pdb
Peptide sequence	ICRVNRNSGSCL
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.6014	4.40538	23.931	126
cluster_2.pdb ( medoid)	26.3243	4.40657	14.7508	116
cluster_3.pdb ( medoid)	17.6306	6.29586	26.9878	111
cluster_4.pdb ( medoid)	11.404	9.38267	20.6735	107
cluster_5.pdb ( medoid)	10.4712	13.1789	36.7652	138
cluster_6.pdb ( medoid)	8.15999	10.4167	29.5067	85
cluster_7.pdb ( medoid)	7.81155	11.2654	29.7606	88
cluster_8.pdb ( medoid)	6.73049	12.9263	28.5412	87
cluster_9.pdb ( medoid)	6.63378	8.89387	22.212	59
cluster_10.pdb ( medoid)	5.7203	14.5097	32.5306	83