Project name: 7T5M_KWTLQD_E2

Status: done

submitted: 2026-05-30 16:09:54, status changed: 2026-05-31 14:14:57

Project settings
Protein sequence(s) GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence KWTLQDVSLEVYLTAP
Simulation mc cycles200
Peptide secondary structure psipred CCCCEEEEEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.3251 4.17481 13.013 160
cluster_2.pdb ( medoid) 29.1249 5.3219 39.1385 155
cluster_3.pdb ( medoid) 28.5407 4.02934 39.8941 115
cluster_4.pdb ( medoid) 26.9228 2.48859 4.13707 67
cluster_5.pdb ( medoid) 21.0963 3.69734 11.3927 78
cluster_6.pdb ( medoid) 14.9134 8.85109 26.2325 132
cluster_7.pdb ( medoid) 13.5284 3.76986 35.9351 51
cluster_8.pdb ( medoid) 6.46632 15.9287 44.2923 103
cluster_9.pdb ( medoid) 5.66329 15.1855 49.3734 86
cluster_10.pdb ( medoid) 1.29329 23.1967 48.9886 30