CABS-dock: 7T5M_KWTLQD

Project name: 7T5M_KWTLQD_E2

Status: done

submitted: 2026-05-30 16:09:54, status changed: 2026-05-31 14:14:57

Project settings

Protein sequence(s)	GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence	KWTLQDVSLEVYLTAP
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCEEEEEEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.3251	4.17481	13.013	160
cluster_2.pdb ( medoid)	29.1249	5.3219	39.1385	155
cluster_3.pdb ( medoid)	28.5407	4.02934	39.8941	115
cluster_4.pdb ( medoid)	26.9228	2.48859	4.13707	67
cluster_5.pdb ( medoid)	21.0963	3.69734	11.3927	78
cluster_6.pdb ( medoid)	14.9134	8.85109	26.2325	132
cluster_7.pdb ( medoid)	13.5284	3.76986	35.9351	51
cluster_8.pdb ( medoid)	6.46632	15.9287	44.2923	103
cluster_9.pdb ( medoid)	5.66329	15.1855	49.3734	86
cluster_10.pdb ( medoid)	1.29329	23.1967	48.9886	30