CABS-dock: d966782a812883e

Project name: d966782a812883e

Status: done

submitted: 2026-07-15 05:09:22, status changed: 2026-07-15 11:24:03

Project settings

Protein sequence(s)	GSHMLEADLELERAADVRWEEQAEISGSSPILSISIKNEEEEQTLGLEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVTRSGAYVSAIAN input pdb
Peptide sequence	DFQNHEAGHFTLGDS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	45.6605	2.27768	15.1813	104
cluster_2.pdb ( medoid)	21.3923	5.79649	33.9437	124
cluster_3.pdb ( medoid)	17.0594	11.7237	37.701	200
cluster_4.pdb ( medoid)	13.139	11.8731	34.7964	156
cluster_5.pdb ( medoid)	11.1294	9.3446	32.1265	104
cluster_6.pdb ( medoid)	6.71501	11.4668	36.1265	77
cluster_7.pdb ( medoid)	5.94754	12.1058	33.1639	72
cluster_8.pdb ( medoid)	3.93602	14.9898	35.3795	59
cluster_9.pdb ( medoid)	3.84209	16.6576	34.4877	64
cluster_10.pdb ( medoid)	2.39219	16.7211	32.545	40