Project name: d966782a812883e

Status: done

submitted: 2026-07-15 05:09:22, status changed: 2026-07-15 11:24:03

Project settings
Protein sequence(s) GSHMLEADLELERAADVRWEEQAEISGSSPILSISIKNEEEEQTLGLEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVTRSGAYVSAIAN input pdb
Peptide sequence DFQNHEAGHFTLGDS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 45.6605 2.27768 15.1813 104
cluster_2.pdb ( medoid) 21.3923 5.79649 33.9437 124
cluster_3.pdb ( medoid) 17.0594 11.7237 37.701 200
cluster_4.pdb ( medoid) 13.139 11.8731 34.7964 156
cluster_5.pdb ( medoid) 11.1294 9.3446 32.1265 104
cluster_6.pdb ( medoid) 6.71501 11.4668 36.1265 77
cluster_7.pdb ( medoid) 5.94754 12.1058 33.1639 72
cluster_8.pdb ( medoid) 3.93602 14.9898 35.3795 59
cluster_9.pdb ( medoid) 3.84209 16.6576 34.4877 64
cluster_10.pdb ( medoid) 2.39219 16.7211 32.545 40