Project name: db5834647b17293

Status: done

submitted: 2026-07-08 08:39:47, status changed: 2026-07-08 11:59:11

Project settings
Protein sequence(s) FKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAAGISYRARVRAWAQAYNTTWSEWSPSTKWH input pdb
Peptide sequence RFLKKLDRLLAG
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.1141 5.88386 18.1399 136
cluster_2.pdb ( medoid) 20.5471 6.86228 18.8594 141
cluster_3.pdb ( medoid) 16.0335 9.29302 28.7488 149
cluster_4.pdb ( medoid) 13.8921 8.49405 25.1552 118
cluster_5.pdb ( medoid) 13.8261 8.17292 28.8461 113
cluster_6.pdb ( medoid) 12.8216 4.75761 27.0938 61
cluster_7.pdb ( medoid) 12.7663 9.63477 26.6638 123
cluster_8.pdb ( medoid) 9.9641 7.52702 15.2875 75
cluster_9.pdb ( medoid) 9.29951 5.16156 33.3845 48
cluster_10.pdb ( medoid) 2.89733 12.4252 35.0192 36