CABS-dock: dbe8376dba44c9e

Project name: dbe8376dba44c9e

Status: done

submitted: 2026-01-14 05:35:57, status changed: 2026-01-14 18:16:38

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RVIVQCFGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.5145	3.25232	28.2672	109
cluster_2.pdb ( medoid)	19.3036	6.47548	35.8592	125
cluster_3.pdb ( medoid)	11.7255	11.6839	40.8706	137
cluster_4.pdb ( medoid)	11.6514	11.2433	50.6828	131
cluster_5.pdb ( medoid)	10.6356	6.95779	19.4642	74
cluster_6.pdb ( medoid)	7.91564	15.2862	53.0182	121
cluster_7.pdb ( medoid)	7.81655	11.7699	28.4206	92
cluster_8.pdb ( medoid)	7.47302	8.56414	31.9718	64
cluster_9.pdb ( medoid)	6.57385	8.06225	25.3025	53
cluster_10.pdb ( medoid)	2.65176	27.1518	59.2017	72