Project name: dc4939abf95e320

Status: done

submitted: 2026-07-10 13:52:17, status changed: 2026-07-10 20:26:43

Project settings
Protein sequence(s) FQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGVDLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTTRRIEDFNPTTNIIPANRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKRVTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGDSLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNGRRNFTTHVMNNQLNAAFVG input pdb
Peptide sequence MNVKGGYKMQVYGGLKM
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 43.5847 2.9827 9.84126 130
cluster_2.pdb ( medoid) 21.8162 5.363 16.8556 117
cluster_3.pdb ( medoid) 21.7827 4.68262 11.8502 102
cluster_4.pdb ( medoid) 18.9156 7.50703 25.6511 142
cluster_5.pdb ( medoid) 16.5423 12.2112 35.0016 202
cluster_6.pdb ( medoid) 14.4262 3.39661 10.5642 49
cluster_7.pdb ( medoid) 9.6079 8.7428 25.7044 84
cluster_8.pdb ( medoid) 8.60267 8.95071 17.8723 77
cluster_9.pdb ( medoid) 5.2969 10.761 20.1151 57
cluster_10.pdb ( medoid) 3.45412 11.5804 36.0718 40