CABS-dock: dd26a41473b891

Project name: dd26a41473b891

Status: done

submitted: 2026-05-09 09:10:52, status changed: 2026-05-09 16:23:19

Project settings

Protein sequence(s)	HCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA input pdb
Peptide sequence	FMDVYQRSYCHPIETLVDIFQEYPDEIEYI
Simulation mc cycles	50
Peptide secondary structure psipred	CCHHHHHHCCCHHHHHHHHHHHCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.0457	3.89042	25.6396	113
cluster_2.pdb ( medoid)	25.9284	5.63089	11.3249	146
cluster_3.pdb ( medoid)	17.6718	6.79049	37.8255	120
cluster_4.pdb ( medoid)	13.5137	10.2859	34.6456	139
cluster_5.pdb ( medoid)	12.2148	7.53186	28.0241	92
cluster_6.pdb ( medoid)	9.60489	17.5952	37.1319	169
cluster_7.pdb ( medoid)	9.23377	9.31364	21.99	86
cluster_8.pdb ( medoid)	4.80347	10.201	19.5424	49
cluster_9.pdb ( medoid)	3.09779	20.0143	43.0605	62
cluster_10.pdb ( medoid)	2.16315	11.0949	18.8723	24