Project name: dd26a41473b891

Status: done

submitted: 2026-05-09 09:10:52, status changed: 2026-05-09 16:23:19

Project settings
Protein sequence(s) HCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA input pdb
Peptide sequence FMDVYQRSYCHPIETLVDIFQEYPDEIEYI
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHCCCHHHHHHHHHHHCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.0457 3.89042 25.6396 113
cluster_2.pdb ( medoid) 25.9284 5.63089 11.3249 146
cluster_3.pdb ( medoid) 17.6718 6.79049 37.8255 120
cluster_4.pdb ( medoid) 13.5137 10.2859 34.6456 139
cluster_5.pdb ( medoid) 12.2148 7.53186 28.0241 92
cluster_6.pdb ( medoid) 9.60489 17.5952 37.1319 169
cluster_7.pdb ( medoid) 9.23377 9.31364 21.99 86
cluster_8.pdb ( medoid) 4.80347 10.201 19.5424 49
cluster_9.pdb ( medoid) 3.09779 20.0143 43.0605 62
cluster_10.pdb ( medoid) 2.16315 11.0949 18.8723 24