CABS-dock: e2291c998adac2

Project name: e2291c998adac2

Status: done

submitted: 2026-01-14 05:38:07, status changed: 2026-01-14 08:48:34

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RVIVQCFGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.5436	4.93275	22.5415	126
cluster_2.pdb ( medoid)	17.5892	7.1635	24.1328	126
cluster_3.pdb ( medoid)	17.0542	9.3232	33.7145	159
cluster_4.pdb ( medoid)	11.3313	10.8549	31.8897	123
cluster_5.pdb ( medoid)	10.727	11.8393	27.8972	127
cluster_6.pdb ( medoid)	6.39247	13.2969	34.2518	85
cluster_7.pdb ( medoid)	5.50198	11.8139	23.9633	65
cluster_8.pdb ( medoid)	5.48906	14.7566	40.5095	81
cluster_9.pdb ( medoid)	3.74248	14.429	29.4368	54
cluster_10.pdb ( medoid)	3.57396	15.1093	32.6022	54