CABS-dock: e56c892b8ed208f

Project name: e56c892b8ed208f

Status: done

submitted: 2026-03-08 14:13:36, status changed: 2026-03-08 16:23:31

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	VQVFGDNNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.3582	4.33666	16.7291	149
cluster_2.pdb ( medoid)	31.6352	5.59502	21.7503	177
cluster_3.pdb ( medoid)	30.4656	4.5297	21.0967	138
cluster_4.pdb ( medoid)	18.1479	5.56539	16.7016	101
cluster_5.pdb ( medoid)	9.53137	12.6949	31.4167	121
cluster_6.pdb ( medoid)	7.96698	8.78626	23.7382	70
cluster_7.pdb ( medoid)	7.46906	9.2381	30.138	69
cluster_8.pdb ( medoid)	5.66102	12.8952	25.1157	73
cluster_9.pdb ( medoid)	4.46595	10.9719	22.3971	49
cluster_10.pdb ( medoid)	3.52625	15.0301	31.393	53