CABS-dock: 8OVI-R2(50-65)

Project name: 8OVI-R2(50-65)

Status: done

submitted: 2026-05-03 17:19:46, status changed: 2026-05-03 18:25:53

Project settings

Protein sequence(s)	GSEHLVTTATFSIGSTGLVVYDYQQLLIAYIPAPGTCCYIMKIAPESIPSLEALTQKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCGEVPLYYI input pdb
Peptide sequence	YGQSSYSSYGQSQNTG
Simulation mc cycles	25
Peptide secondary structure psipred	CCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.8228	5.07917	22.2882	121
cluster_2.pdb ( medoid)	16.8263	6.35908	29.313	107
cluster_3.pdb ( medoid)	13.9371	9.9734	26.0684	139
cluster_4.pdb ( medoid)	13.7798	8.4181	32.4929	116
cluster_5.pdb ( medoid)	12.6442	7.6715	20.3024	97
cluster_6.pdb ( medoid)	10.6911	11.5984	26.8452	124
cluster_7.pdb ( medoid)	9.09925	12.3087	28.9568	112
cluster_8.pdb ( medoid)	8.36508	11.8349	40.9504	99
cluster_9.pdb ( medoid)	4.84167	9.50085	19.5762	46
cluster_10.pdb ( medoid)	3.36616	11.5859	26.4898	39