Project name: 8OVI-R2(50-65)

Status: done

submitted: 2026-05-03 17:19:46, status changed: 2026-05-03 18:25:53

Project settings
Protein sequence(s) GSEHLVTTATFSIGSTGLVVYDYQQLLIAYIPAPGTCCYIMKIAPESIPSLEALTQKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCGEVPLYYI input pdb
Peptide sequence YGQSSYSSYGQSQNTG
Simulation mc cycles25
Peptide secondary structure psipred CCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.8228 5.07917 22.2882 121
cluster_2.pdb ( medoid) 16.8263 6.35908 29.313 107
cluster_3.pdb ( medoid) 13.9371 9.9734 26.0684 139
cluster_4.pdb ( medoid) 13.7798 8.4181 32.4929 116
cluster_5.pdb ( medoid) 12.6442 7.6715 20.3024 97
cluster_6.pdb ( medoid) 10.6911 11.5984 26.8452 124
cluster_7.pdb ( medoid) 9.09925 12.3087 28.9568 112
cluster_8.pdb ( medoid) 8.36508 11.8349 40.9504 99
cluster_9.pdb ( medoid) 4.84167 9.50085 19.5762 46
cluster_10.pdb ( medoid) 3.36616 11.5859 26.4898 39