CABS-dock: e6e346cb88ba111

Project name: e6e346cb88ba111

Status: done

submitted: 2026-07-22 09:14:32, status changed: 2026-07-22 11:14:48

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRRVIRVVQCGSNC
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.3819	7.38941	29.2646	158
cluster_2.pdb ( medoid)	18.3102	9.22982	28.473	169
cluster_3.pdb ( medoid)	16.1267	8.55722	24.9039	138
cluster_4.pdb ( medoid)	12.9278	12.9179	32.9721	167
cluster_5.pdb ( medoid)	5.78346	13.4867	23.0581	78
cluster_6.pdb ( medoid)	5.39989	13.8892	27.7144	75
cluster_7.pdb ( medoid)	5.25228	13.1372	25.6525	69
cluster_8.pdb ( medoid)	4.09358	12.4585	24.0772	51
cluster_9.pdb ( medoid)	3.92635	14.0079	28.2113	55
cluster_10.pdb ( medoid)	3.26716	12.2431	22.811	40