Project name: e6e346cb88ba111

Status: done

submitted: 2026-07-22 09:14:32, status changed: 2026-07-22 11:14:48

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRRVIRVVQCGSNC
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.3819 7.38941 29.2646 158
cluster_2.pdb ( medoid) 18.3102 9.22982 28.473 169
cluster_3.pdb ( medoid) 16.1267 8.55722 24.9039 138
cluster_4.pdb ( medoid) 12.9278 12.9179 32.9721 167
cluster_5.pdb ( medoid) 5.78346 13.4867 23.0581 78
cluster_6.pdb ( medoid) 5.39989 13.8892 27.7144 75
cluster_7.pdb ( medoid) 5.25228 13.1372 25.6525 69
cluster_8.pdb ( medoid) 4.09358 12.4585 24.0772 51
cluster_9.pdb ( medoid) 3.92635 14.0079 28.2113 55
cluster_10.pdb ( medoid) 3.26716 12.2431 22.811 40