CABS-dock: e8b25e5b7aed1e

Project name: e8b25e5b7aed1e

Status: done

submitted: 2026-06-17 06:48:39, status changed: 2026-06-17 14:07:09

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRVQLFGSNDARRYHHHHHHHHHHH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEECCCCHHHHCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.709	4.19335	29.6485	112
cluster_2.pdb ( medoid)	20.5666	6.66129	30.2503	137
cluster_3.pdb ( medoid)	15.2901	7.45579	33.0634	114
cluster_4.pdb ( medoid)	9.46439	16.0602	28.8938	152
cluster_5.pdb ( medoid)	8.51315	16.0927	33.0995	137
cluster_6.pdb ( medoid)	7.15224	11.6048	25.6016	83
cluster_7.pdb ( medoid)	5.12213	16.5946	34.9493	85
cluster_8.pdb ( medoid)	5.11579	15.6379	32.0798	80
cluster_9.pdb ( medoid)	4.52782	15.0183	31.6141	68
cluster_10.pdb ( medoid)	3.50433	9.13156	22.5278	32