Project name: e8b25e5b7aed1e

Status: done

submitted: 2026-06-17 06:48:39, status changed: 2026-06-17 14:07:09

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRRVQLFGSNDARRYHHHHHHHHHHH
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEECCCCHHHHCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.709 4.19335 29.6485 112
cluster_2.pdb ( medoid) 20.5666 6.66129 30.2503 137
cluster_3.pdb ( medoid) 15.2901 7.45579 33.0634 114
cluster_4.pdb ( medoid) 9.46439 16.0602 28.8938 152
cluster_5.pdb ( medoid) 8.51315 16.0927 33.0995 137
cluster_6.pdb ( medoid) 7.15224 11.6048 25.6016 83
cluster_7.pdb ( medoid) 5.12213 16.5946 34.9493 85
cluster_8.pdb ( medoid) 5.11579 15.6379 32.0798 80
cluster_9.pdb ( medoid) 4.52782 15.0183 31.6141 68
cluster_10.pdb ( medoid) 3.50433 9.13156 22.5278 32