CABS-dock: e8d59a25b97e3ab

Project name: e8d59a25b97e3ab

Status: done

submitted: 2026-07-22 04:55:50, status changed: 2026-07-22 10:18:37

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	VQCGSNCRRVIRRV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.4479	6.55901	41.7863	121
cluster_2.pdb ( medoid)	16.6233	9.80549	43.282	163
cluster_3.pdb ( medoid)	16.0696	9.89443	33.0004	159
cluster_4.pdb ( medoid)	9.05405	12.7015	26.7216	115
cluster_5.pdb ( medoid)	8.29171	16.4019	51.5609	136
cluster_6.pdb ( medoid)	5.62435	12.0903	31.6525	68
cluster_7.pdb ( medoid)	4.61696	15.3781	34.8453	71
cluster_8.pdb ( medoid)	4.27948	16.1234	45.4911	69
cluster_9.pdb ( medoid)	3.54771	14.9392	41.0038	53
cluster_10.pdb ( medoid)	2.18234	20.62	42.0397	45