Project name: e8d59a25b97e3ab

Status: done

submitted: 2026-07-22 04:55:50, status changed: 2026-07-22 10:18:37

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence VQCGSNCRRVIRRV
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.4479 6.55901 41.7863 121
cluster_2.pdb ( medoid) 16.6233 9.80549 43.282 163
cluster_3.pdb ( medoid) 16.0696 9.89443 33.0004 159
cluster_4.pdb ( medoid) 9.05405 12.7015 26.7216 115
cluster_5.pdb ( medoid) 8.29171 16.4019 51.5609 136
cluster_6.pdb ( medoid) 5.62435 12.0903 31.6525 68
cluster_7.pdb ( medoid) 4.61696 15.3781 34.8453 71
cluster_8.pdb ( medoid) 4.27948 16.1234 45.4911 69
cluster_9.pdb ( medoid) 3.54771 14.9392 41.0038 53
cluster_10.pdb ( medoid) 2.18234 20.62 42.0397 45