CABS-dock: ecd42c9669b49d2

Project name: ecd42c9669b49d2

Status: done

submitted: 2026-04-10 15:24:42, status changed: 2026-04-10 19:52:13

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRVQPYGSNDARRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.1425	6.19604	33.4952	131
cluster_2.pdb ( medoid)	19.5064	3.48603	35.4517	68
cluster_3.pdb ( medoid)	14.8739	9.47968	42.0325	141
cluster_4.pdb ( medoid)	10.116	12.9498	35.7742	131
cluster_5.pdb ( medoid)	10.0375	13.3499	39.8477	134
cluster_6.pdb ( medoid)	9.12311	12.715	32.1301	116
cluster_7.pdb ( medoid)	7.23962	14.6417	33.5375	106
cluster_8.pdb ( medoid)	5.02114	12.547	35.1164	63
cluster_9.pdb ( medoid)	3.52821	15.8721	32.223	56
cluster_10.pdb ( medoid)	3.01545	17.9078	32.7315	54