CABS-dock: DRAMP00837M

Project name: DRAMP00837M

Status: done

submitted: 2024-07-25 15:34:34, status changed: 2024-07-25 23:14:03

Project settings

Protein sequence(s)

SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ input pdb

Peptide sequence

GIPCAESCVWIPCTVTALVGCSCSDKVCYN

Simulation mc cycles

Peptide secondary structure psipred

CCCCCCCCEEEEECHHHHHCCCCCCCCCCC

Contact information

163:A 1:PEP 5.0 1.0

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.7239	4.03716	26.0314	120
cluster_2.pdb ( medoid)	21.2105	5.94044	17.0316	126
cluster_3.pdb ( medoid)	19.7276	5.01836	18.7678	99
cluster_4.pdb ( medoid)	15.654	7.66577	19.3543	120
cluster_5.pdb ( medoid)	13.3843	8.06914	29.4638	108
cluster_6.pdb ( medoid)	12.2798	6.51475	19.6448	80
cluster_7.pdb ( medoid)	7.43267	8.47609	21.6664	63
cluster_8.pdb ( medoid)	6.60854	10.5924	29.9678	70
cluster_9.pdb ( medoid)	6.52898	11.4872	37.5336	75
cluster_10.pdb ( medoid)	3.16377	19.5969	46.3993	62