Project name: f341be9c2808196

Status: done

submitted: 2026-07-13 11:37:56, status changed: 2026-07-13 14:31:22

Project settings
Protein sequence(s) GTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS input pdb
Peptide sequence AAAAAAAAAA
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHC
Contact information
267:A 3:PEP 8.0 1.0
298:A 5:PEP 8.0 1.0
317:A 7:PEP 8.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.9759 4.58421 10.7216 142
cluster_2.pdb ( medoid) 24.8331 5.19469 10.5388 129
cluster_3.pdb ( medoid) 22.8919 5.76623 13.6539 132
cluster_4.pdb ( medoid) 20.6924 4.05946 11.1595 84
cluster_5.pdb ( medoid) 20.4618 5.52249 20.138 113
cluster_6.pdb ( medoid) 20.2457 3.90207 10.3267 79
cluster_7.pdb ( medoid) 18.843 3.82105 8.31466 72
cluster_8.pdb ( medoid) 18.4299 3.25558 9.09395 60
cluster_9.pdb ( medoid) 17.3381 7.15186 18.4693 124
cluster_10.pdb ( medoid) 15.2962 4.24943 10.2089 65