CABS-dock: f65c735e50f22d6

Project name: f65c735e50f22d6

Status: done

submitted: 2026-01-16 10:00:06, status changed: 2026-01-16 13:21:28

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RVIVQVGFSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.0302	7.56056	27.4735	159
cluster_2.pdb ( medoid)	17.94	7.97102	36.4021	143
cluster_3.pdb ( medoid)	12.916	10.2973	25.0558	133
cluster_4.pdb ( medoid)	9.4164	10.8322	27.6762	102
cluster_5.pdb ( medoid)	9.23969	8.33361	28.0125	77
cluster_6.pdb ( medoid)	8.46027	11.5836	28.1887	98
cluster_7.pdb ( medoid)	8.18603	11.1165	30.4542	91
cluster_8.pdb ( medoid)	6.7705	10.6344	32.9605	72
cluster_9.pdb ( medoid)	5.86118	13.4785	35.8975	79
cluster_10.pdb ( medoid)	3.27149	14.0609	28.7407	46