Project name: f764acf4c2d8bfe

Status: done

submitted: 2026-07-08 11:09:09, status changed: 2026-07-08 14:55:44

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence MGGHETQSHFGYDRR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.2716 6.17294 31.4322 156
cluster_2.pdb ( medoid) 22.2626 4.98594 41.0871 111
cluster_3.pdb ( medoid) 19.1336 6.68979 35.6356 128
cluster_4.pdb ( medoid) 16.2677 10.2043 29.6311 166
cluster_5.pdb ( medoid) 11.3746 9.67069 29.165 110
cluster_6.pdb ( medoid) 8.99477 9.00523 21.4517 81
cluster_7.pdb ( medoid) 7.8302 8.4289 21.2271 66
cluster_8.pdb ( medoid) 5.36948 17.5063 44.5662 94
cluster_9.pdb ( medoid) 4.98834 8.21916 16.8627 41
cluster_10.pdb ( medoid) 2.55395 18.4029 39.0801 47