CABS-dock: CREB5_350_430_cJun_76_105

Project name: CREB5_350_430_cJun_76_105_run1

Status: done

submitted: 2026-07-16 06:06:29, status changed: 2026-07-16 08:28:40

Project settings

Protein sequence(s)	MQPTQTIQPPQPTGGRRRKVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ input pdb
Peptide sequence	IQSSNGHITTTPTPTQFLCPKNVTDEQEGF
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCCCCEECCCCCCEEECCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	17.1411	7.05905	31.9622	121
cluster_2.pdb ( medoid)	15.8108	8.15898	29.6841	129
cluster_3.pdb ( medoid)	13.4606	3.3431	17.3684	45
cluster_4.pdb ( medoid)	9.91721	15.6294	43.6944	155
cluster_5.pdb ( medoid)	9.45172	3.38563	17.6138	32
cluster_6.pdb ( medoid)	8.75607	16.3315	32.2705	143
cluster_7.pdb ( medoid)	8.6678	15.8056	36.0534	137
cluster_8.pdb ( medoid)	5.77302	16.1094	34.1492	93
cluster_9.pdb ( medoid)	4.18499	11.4696	31.8144	48
cluster_10.pdb ( medoid)	1.85593	26.9406	51.1318	50