Project name: CREB5_350_430_cJun_76_105_run1

Status: done

submitted: 2026-07-16 06:06:29, status changed: 2026-07-16 08:28:40

Project settings
Protein sequence(s) MQPTQTIQPPQPTGGRRRKVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ input pdb
Peptide sequence IQSSNGHITTTPTPTQFLCPKNVTDEQEGF
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCEECCCCCCEEECCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 17.1411 7.05905 31.9622 121
cluster_2.pdb ( medoid) 15.8108 8.15898 29.6841 129
cluster_3.pdb ( medoid) 13.4606 3.3431 17.3684 45
cluster_4.pdb ( medoid) 9.91721 15.6294 43.6944 155
cluster_5.pdb ( medoid) 9.45172 3.38563 17.6138 32
cluster_6.pdb ( medoid) 8.75607 16.3315 32.2705 143
cluster_7.pdb ( medoid) 8.6678 15.8056 36.0534 137
cluster_8.pdb ( medoid) 5.77302 16.1094 34.1492 93
cluster_9.pdb ( medoid) 4.18499 11.4696 31.8144 48
cluster_10.pdb ( medoid) 1.85593 26.9406 51.1318 50