Project name: 10af288257907eb

Status: done

Started: 2026-03-10 18:04:03
Chain sequence(s) A: MHHHHHHFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTGGGGSGGGGSDDRFNDVNTINKKQFTEEEFSRLINSMLKEYIEDNKKDKHPTQKTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKPKSIADIFLINKPKVPLWIVNPLYYMVEKFVQIMGYLLEDDDTLELNLPKYYYDKSI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:20)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/10af288257907eb/tmp/folded.pdb                (00:05:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:56)
Show buried residues

Minimal score value
-5.316
Maximal score value
3.3027
Average score
-0.8756
Total score value
-285.4514

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1809
2 H A -1.3746
3 H A -2.1058
4 H A -2.5396
5 H A -2.6476
6 H A -2.5643
7 H A -2.2796
8 F A -1.7525
9 D A -2.5035
10 A A -2.0019
11 S A -2.0841
12 N A -2.3249
13 F A 0.0000
14 K A -2.1125
15 D A -1.0301
16 F A -0.3261
17 S A -0.5716
18 S A -1.1362
19 I A 0.0000
20 A A -0.4133
21 S A -0.8563
22 A A -0.9730
23 S A -0.6279
24 S A 0.0000
25 S A -0.1887
26 W A 0.0000
27 Q A -1.2707
28 N A 0.0000
29 Q A -1.8891
30 S A -1.3989
31 G A -1.3348
32 S A 0.0000
33 T A -0.8927
34 M A 0.0000
35 I A -0.0590
36 I A 0.0000
37 Q A -1.4479
38 V A 0.0000
39 D A -0.7531
40 S A 0.3247
41 F A 1.1199
42 G A 0.0000
43 N A -1.1461
44 V A 0.0000
45 S A -1.1461
46 G A -0.7564
47 Q A -0.7975
48 Y A 0.0000
49 V A 0.0000
50 N A 0.0000
51 R A -2.6246
52 A A -1.9366
53 Q A -1.9532
54 G A -1.3848
55 T A -1.1002
56 G A -1.3783
57 C A 0.0000
58 Q A -2.3007
59 N A -2.1104
60 S A -1.5300
61 P A -1.1779
62 Y A 0.0000
63 P A -0.8462
64 L A 0.0000
65 T A -0.9588
66 G A -1.2222
67 R A -1.9415
68 V A 0.0000
69 N A -0.9858
70 G A -0.4998
71 T A 0.1095
72 F A 1.1160
73 I A 0.0000
74 A A -0.4376
75 F A 0.0000
76 S A -0.6343
77 V A 0.0000
78 G A -1.0909
79 W A 0.0000
80 N A -2.5628
81 N A -1.7547
82 S A -1.2079
83 T A -1.3122
84 E A -2.4987
85 N A -2.5609
86 C A -1.6936
87 N A -2.1269
88 S A -1.0948
89 A A -0.4553
90 T A 0.0000
91 G A -0.6281
92 W A 0.0000
93 T A -0.0877
94 G A 0.0000
95 Y A 1.1613
96 A A 0.0000
97 Q A -0.3975
98 V A -1.1643
99 N A -1.7781
100 G A -1.6541
101 N A -2.1815
102 N A -1.7250
103 T A 0.0000
104 E A -0.8376
105 I A 0.0000
106 V A 0.2143
107 T A 0.0000
108 S A -0.9976
109 W A -1.0366
110 N A -1.0839
111 L A -0.2608
112 A A -0.0480
113 Y A -0.4335
114 E A -1.8078
115 G A -1.0424
116 G A -1.0711
117 S A -0.9132
118 G A -1.0550
119 P A -0.7790
120 A A -0.0079
121 I A 1.0449
122 E A -0.4677
123 Q A -1.6640
124 G A -1.6911
125 Q A -1.8282
126 D A -1.2332
127 T A -0.8971
128 F A 0.0000
129 Q A -1.2832
130 Y A 0.0000
131 V A 0.1987
132 P A -0.5842
133 T A -0.8426
134 T A -1.5739
135 E A -3.0556
136 N A -2.8360
137 K A -2.5368
138 S A -0.9168
139 L A 0.8237
140 L A 0.6652
141 K A -1.7017
142 D A -2.2676
143 T A -1.6531
144 G A -1.6552
145 G A -1.3566
146 G A -1.1621
147 G A -1.1648
148 S A -1.0041
149 G A -1.1189
150 G A -1.1559
151 G A -1.2455
152 G A -1.4348
153 S A -1.6654
154 D A -2.5318
155 D A -3.3201
156 R A -2.6715
157 F A -0.6626
158 N A -2.1998
159 D A -1.6662
160 V A 0.5815
161 N A -0.8971
162 T A -0.8020
163 I A 0.4464
164 N A -1.8641
165 K A -2.9200
166 K A -2.8083
167 Q A -2.1940
168 F A -0.0252
169 T A -1.2046
170 E A -2.0968
171 E A -2.1818
172 E A -0.8809
173 F A 0.9941
174 S A -0.4871
175 R A -1.1640
176 L A 1.0764
177 I A 1.7424
178 N A -0.1388
179 S A -0.0188
180 M A 0.6889
181 L A 0.5685
182 K A -1.6670
183 E A -2.5706
184 Y A -0.5884
185 I A -0.8699
186 E A -3.9122
187 D A -4.6161
188 N A -4.3219
189 K A -5.0441
190 K A -5.3160
191 D A -5.1770
192 K A -4.5856
193 H A -3.2316
194 P A -1.9968
195 T A -1.6805
196 Q A -2.2772
197 K A -2.4240
198 T A -1.5316
199 T A -1.2391
200 P A -1.4152
201 K A -1.9983
202 P A -1.2331
203 T A -0.9359
204 T A -1.0172
205 P A -1.2269
206 K A -2.0713
207 Q A -1.4400
208 I A -0.0884
209 N A -1.7410
210 D A -2.2445
211 G A -1.6627
212 T A -1.3510
213 S A -1.8743
214 D A -2.8327
215 K A -2.9223
216 T A -1.9018
217 S A -1.8764
218 D A -2.3927
219 T A -1.2870
220 H A -1.1970
221 T A -0.4442
222 I A 0.4020
223 K A -1.7803
224 R A -2.2710
225 T A -1.4737
226 T A -1.3008
227 P A -1.4024
228 K A -1.9997
229 P A -1.2237
230 T A -0.9466
231 T A -1.0335
232 P A -1.2291
233 K A -2.0868
234 Q A -1.6656
235 I A -0.1357
236 N A -1.7970
237 D A -2.3275
238 G A -1.7364
239 T A -1.3694
240 S A -1.8607
241 D A -2.8354
242 K A -2.9283
243 T A -1.9104
244 S A -1.8891
245 D A -2.3901
246 T A -1.2771
247 H A -1.1347
248 T A -0.1773
249 I A 0.4419
250 K A -1.7745
251 R A -2.3125
252 T A -1.4577
253 T A -1.2522
254 P A -1.4165
255 K A -1.9888
256 P A -1.2296
257 T A -0.9670
258 T A -0.8202
259 P A -1.2134
260 K A -2.0568
261 Q A -1.6835
262 I A -0.2089
263 N A -1.7901
264 D A -2.3227
265 G A -1.7522
266 T A -1.7957
267 S A -1.9916
268 D A -3.0679
269 K A -3.1201
270 P A -1.1805
271 K A -2.0575
272 S A 0.0604
273 I A 2.3477
274 A A 2.0600
275 D A 1.4161
276 I A 2.2728
277 F A 3.0938
278 L A 2.8439
279 I A 2.3396
280 N A -0.0881
281 K A -0.9767
282 P A -1.2807
283 K A -1.7087
284 V A 0.7714
285 P A 1.5519
286 L A 2.5742
287 W A 2.8819
288 I A 3.3027
289 V A 2.8437
290 N A 2.0865
291 P A 2.2017
292 L A 2.7866
293 Y A 2.8977
294 Y A 2.5313
295 M A 2.7466
296 V A 3.0344
297 E A 0.6616
298 K A 0.4819
299 F A 2.8660
300 V A 2.5987
301 Q A 1.1886
302 I A 2.3110
303 M A 2.2687
304 G A 1.9523
305 Y A 2.3196
306 L A 2.4541
307 L A 1.1527
308 E A -1.7965
309 D A -3.1390
310 D A -3.7139
311 D A -3.3531
312 T A -1.6270
313 L A -0.4222
314 E A -0.9205
315 L A 0.6110
316 N A -0.7170
317 L A 0.3345
318 P A 0.2155
319 K A -0.5798
320 Y A 1.2526
321 Y A 1.5285
322 Y A 0.6145
323 D A -1.3022
324 K A -1.6950
325 S A -0.4346
326 I A 1.2017
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3984 6.3039 View CSV PDB
4.5 -0.4849 6.2766 View CSV PDB
5.0 -0.5854 6.2626 View CSV PDB
5.5 -0.6762 6.278 View CSV PDB
6.0 -0.7328 6.3293 View CSV PDB
6.5 -0.7436 6.4055 View CSV PDB
7.0 -0.7173 6.4935 View CSV PDB
7.5 -0.6707 6.5866 View CSV PDB
8.0 -0.6131 6.684 View CSV PDB
8.5 -0.5447 6.7878 View CSV PDB
9.0 -0.4636 6.8979 View CSV PDB