Project name: 3cb189884b86ef7 [mutate: PL212A]

Status: done

Started: 2026-06-02 16:05:02
Chain sequence(s) A: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues PL212A
Energy difference between WT (input) and mutated protein (by FoldX) 0.882217 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:01:36)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:40)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/10e6bb538984f41/tmp/folded.pdb                (00:01:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:49)
Show buried residues

Minimal score value
-4.327
Maximal score value
2.7723
Average score
-1.0008
Total score value
-352.2891

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.5941
2 A A -0.6015
3 E A -2.2434
4 P A -2.4245
5 R A -3.2311
6 Q A -2.9710
7 E A -2.2442
8 F A 0.2655
9 E A -0.6123
10 V A 0.9696
11 M A 0.1540
12 E A -2.2105
13 D A -2.6625
14 H A -2.3669
15 A A -1.2283
16 G A -0.6955
17 T A 0.3329
18 Y A 1.1888
19 G A 0.4787
20 L A 0.6452
21 G A -1.2534
22 D A -3.2539
23 R A -4.0443
24 K A -4.3270
25 D A -4.0607
26 Q A -2.9412
27 G A -1.3574
28 G A -0.4826
29 Y A 0.8973
30 T A 0.5252
31 M A 0.1899
32 H A -1.4947
33 Q A -2.8046
34 D A -3.6816
35 Q A -3.7390
36 E A -3.8197
37 G A -3.0653
38 D A -3.2182
39 T A -2.2580
40 D A -2.2898
41 A A -1.0812
42 G A -0.6540
43 L A 0.0731
44 K A -1.7642
45 A A -1.7825
46 E A -2.9864
47 E A -2.6992
48 A A -1.1045
49 G A -0.6149
50 I A 0.8262
51 G A -0.5414
52 D A -1.7148
53 T A -0.7400
54 P A -0.7801
55 S A -0.6415
56 L A -0.2434
57 E A -2.5279
58 D A -3.1394
59 E A -2.9857
60 A A -1.8330
61 A A -0.9898
62 G A -0.6693
63 H A -0.5111
64 V A 0.8203
65 T A -0.3510
66 Q A -1.2189
67 A A -0.7200
68 R A -1.1947
69 M A 0.6066
70 V A 1.1829
71 S A -0.3702
72 K A -1.9541
73 S A -2.1964
74 K A -3.2937
75 D A -3.1615
76 G A -1.9717
77 T A -1.3595
78 G A -1.4754
79 S A -1.9964
80 D A -3.2740
81 D A -3.9874
82 K A -3.8861
83 K A -3.2876
84 A A -2.0954
85 K A -2.2202
86 G A -1.6839
87 A A -1.5734
88 D A -2.4850
89 G A -2.3837
90 K A -2.5913
91 T A -1.4038
92 K A -1.2251
93 I A 0.9766
94 A A 0.3049
95 T A -0.2780
96 P A -1.0469
97 R A -2.1961
98 G A -1.4183
99 A A -0.6138
100 A A -0.2548
101 P A -0.4876
102 P A -1.0259
103 G A -1.6221
104 Q A -2.5626
105 K A -2.9268
106 G A -2.3492
107 Q A -2.2350
108 A A -1.4335
109 N A -1.7374
110 A A -0.9640
111 T A -0.7341
112 R A -1.0804
113 I A 0.9903
114 P A -0.1188
115 A A -0.6165
116 K A -1.8208
117 T A -1.1970
118 P A -0.7871
119 P A -0.4330
120 A A -0.6129
121 P A -1.1478
122 K A -1.9028
123 T A -1.1392
124 P A -0.8959
125 P A -0.5931
126 S A -0.8082
127 S A -1.0805
128 G A -1.6076
129 E A -2.5054
130 P A -1.8547
131 P A -1.7854
132 K A -2.5461
133 S A -2.0993
134 G A -2.4180
135 D A -3.2963
136 R A -2.9067
137 S A -1.5963
138 G A -0.7706
139 Y A 0.5866
140 S A 0.0171
141 S A -0.2911
142 P A -0.5555
143 G A -0.9099
144 S A -0.7736
145 P A -0.7778
146 G A -0.8750
147 T A -0.6502
148 P A -0.9542
149 G A -1.3087
150 S A -1.6848
151 R A -2.6590
152 S A -2.1836
153 R A -2.5097
154 T A -1.0159
155 P A -0.4705
156 S A 0.3298
157 L A 1.2127
158 P A 0.3048
159 T A -0.0717
160 P A -0.5673
161 P A -1.0817
162 T A -1.6935
163 R A -3.2412
164 E A -3.5815
165 P A -2.6340
166 K A -2.9562
167 K A -1.7118
168 V A 1.2179
169 A A 1.3341
170 V A 2.3626
171 V A 1.9426
172 R A -0.5491
173 T A -0.6454
174 P A -1.1831
175 P A -1.6296
176 K A -2.0979
177 S A -1.3820
178 P A -0.9760
179 S A -0.9122
180 S A -1.1125
181 A A -1.3698
182 K A -2.1867
183 S A -1.7099
184 R A -2.0502
185 L A -0.2551
186 Q A -1.0663
187 T A -0.2276
188 A A 0.2215
189 P A 0.5581
190 V A 1.7997
191 P A 0.6871
192 M A 1.0577
193 P A -0.1817
194 D A -1.5215
195 L A -0.1741
196 K A -1.9917
197 N A -1.6910
198 V A -0.2359
199 K A -1.5622
200 S A -1.0453
201 K A -1.1332
202 I A 0.4801
203 G A -0.9821
204 S A -0.7190
205 T A -1.0117
206 E A -2.3990
207 N A -2.5717
208 L A -0.9076
209 K A -2.3297
210 H A -2.3171
211 Q A -1.5352
212 L A 0.0658 mutated: PL212A
213 G A -0.7266
214 G A -0.7340
215 G A -1.0865
216 K A -1.3333
217 V A 0.9591
218 Q A 0.8103
219 I A 2.7287
220 V A 2.7723
221 Y A 1.9272
222 K A -0.1304
223 P A 0.1326
224 V A 0.9317
225 D A -0.5652
226 L A 1.1212
227 S A -0.1093
228 K A -0.8054
229 V A 0.8518
230 T A 0.0892
231 S A -0.4515
232 K A -1.3769
233 C A -0.2978
234 G A -0.5427
235 S A 0.2185
236 L A 1.2853
237 G A -0.2451
238 N A -1.0801
239 I A 0.7250
240 H A -1.2331
241 H A -2.3648
242 K A -2.6482
243 P A -1.8859
244 G A -1.6540
245 G A -1.1817
246 G A -1.1965
247 Q A -1.0159
248 V A 0.3583
249 E A -1.0134
250 V A 0.1215
251 K A -1.9550
252 S A -2.0003
253 E A -2.9064
254 K A -2.5784
255 L A -1.1022
256 D A -2.1174
257 F A -0.7457
258 K A -2.4593
259 D A -3.0869
260 R A -2.2794
261 V A -0.6289
262 Q A -1.5180
263 S A -0.5333
264 K A -1.0104
265 I A 0.6733
266 G A -0.5229
267 S A 0.2523
268 L A 0.9831
269 D A -1.2137
270 N A -0.9198
271 I A 1.2930
272 T A 0.3566
273 H A -0.4182
274 V A 1.0695
275 P A -0.0859
276 G A -0.7786
277 G A -1.4075
278 G A -2.0370
279 N A -2.7272
280 K A -3.0668
281 K A -2.4682
282 I A -0.4684
283 E A -1.9695
284 T A -1.4338
285 H A -1.7963
286 K A -1.6688
287 L A -0.1290
288 T A -0.5279
289 F A -0.0505
290 R A -2.2253
291 E A -2.8862
292 N A -2.3282
293 A A -1.9326
294 K A -2.6786
295 A A -1.9531
296 K A -3.0190
297 T A -2.4107
298 D A -2.8637
299 H A -2.5483
300 G A -1.9483
301 A A -1.1201
302 E A -0.7761
303 I A 1.8710
304 V A 2.3514
305 Y A 1.5739
306 K A -0.1815
307 S A 0.1725
308 P A 0.7028
309 V A 2.0559
310 V A 2.0145
311 S A 0.5164
312 G A -0.7416
313 D A -1.9236
314 T A -1.3133
315 S A -1.4557
316 P A -1.4851
317 R A -2.1942
318 H A -1.4572
319 L A 0.4037
320 S A -0.1217
321 N A -0.3345
322 V A 1.1280
323 S A 0.0839
324 S A -0.2280
325 T A -0.0577
326 G A -0.4049
327 S A 0.1414
328 I A 1.4519
329 D A -0.1639
330 M A 0.9395
331 V A 1.0342
332 D A -1.1882
333 S A -0.6095
334 P A -0.3641
335 Q A -0.2420
336 L A 1.0629
337 A A 0.1720
338 T A -0.0961
339 L A 0.8913
340 A A 0.1132
341 D A -1.4121
342 E A -1.1003
343 V A 0.8700
344 S A -0.0733
345 A A -0.7780
346 S A -0.5067
347 L A 0.3213
348 A A -0.4078
349 K A -1.8563
350 Q A -1.4093
351 G A -0.5931
352 L A 0.9340
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6296 4.2504 View CSV PDB
4.5 -0.7284 4.1847 View CSV PDB
5.0 -0.8417 4.1249 View CSV PDB
5.5 -0.9434 4.1249 View CSV PDB
6.0 -1.006 4.1249 View CSV PDB
6.5 -1.0149 4.1249 View CSV PDB
7.0 -0.98 4.1249 View CSV PDB
7.5 -0.9221 4.1249 View CSV PDB
8.0 -0.8526 4.1249 View CSV PDB
8.5 -0.7716 4.1249 View CSV PDB
9.0 -0.6755 4.1249 View CSV PDB