Project name: VAAA_R4

Status: done

Started: 2026-08-21 04:38:56
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:01)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/11b697a13a34056/tmp/folded.pdb                (00:02:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:18)
Show buried residues

Minimal score value
-2.6942
Maximal score value
1.9897
Average score
-0.5381
Total score value
-133.4365

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6952
2 V A 0.0000
3 Q A -2.0722
4 L A 0.0000
5 Q A -1.8537
6 E A 0.0000
7 S A -0.6844
8 G A -0.3696
9 P A 0.0482
10 G A 0.4081
11 L A 0.9825
12 V A 0.0000
13 K A -1.8484
14 P A -1.3387
15 S A -1.4250
16 Q A -1.9946
17 T A -1.5961
18 L A 0.0000
19 S A -0.9894
20 L A 0.0000
21 T A -0.6407
22 V A 0.0000
23 T A -1.2354
24 V A 0.0000
25 S A -1.3901
26 G A -1.4208
27 G A -1.0969
28 S A -0.6485
29 I A 0.0000
30 S A -0.3997
31 S A -0.5907
32 G A -0.4970
33 D A -0.8002
34 Y A 0.2319
35 Y A 0.3551
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6493
43 P A -0.6502
44 G A -1.1161
45 C A -1.2179
46 K A -2.0257
47 G A -1.2545
48 L A 0.0000
49 E A -0.7278
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.0916
54 I A 0.0000
55 Y A 0.1167
56 Y A 0.1304
57 S A -0.1456
58 G A -0.2718
59 S A -0.2969
60 T A -0.2794
61 D A -0.7047
62 Y A -0.7037
63 N A -0.9065
64 P A -1.2114
65 S A -1.0687
66 L A 0.0000
67 K A -2.0828
68 S A -1.3881
69 R A -1.5966
70 V A 0.0000
71 T A -1.0815
72 M A 0.0000
73 S A -0.4039
74 V A -0.3809
75 D A -1.1969
76 T A -1.0624
77 S A -1.3270
78 K A -2.1678
79 N A -1.4526
80 Q A -1.2653
81 F A 0.0000
82 S A -0.5557
83 L A 0.0000
84 K A -1.5909
85 V A 0.0000
86 N A -1.6475
87 S A -1.4960
88 V A 0.0000
89 T A -0.6777
90 A A -0.3581
91 A A -0.0976
92 D A 0.0000
93 T A 0.2884
94 A A 0.0000
95 V A 0.2820
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.7426
104 F A 1.9897
105 G A 0.9741
106 V A 1.1037
107 G A 1.1165
108 T A 0.0000
109 F A 0.0000
110 D A -0.5328
111 Y A -0.6130
112 W A -0.8266
113 G A 0.0000
114 Q A -1.6210
115 G A -0.7108
116 T A -0.1283
117 L A 0.9443
118 V A 0.0000
119 T A 0.3742
120 V A 0.0000
121 S A -0.3835
122 S A -0.7135
123 A A -0.6308
124 A A -0.3604
125 G A -0.8400
126 G A -1.0797
127 G A -1.1461
128 G A -1.1613
129 S A -1.0160
130 G A -1.1583
131 G A -1.2030
132 G A -1.1778
133 G A -1.2100
134 S A -0.8715
135 G A -1.2173
136 G A -1.1966
137 G A -1.2810
138 G A -1.1882
139 S A -0.8740
140 D A -0.8942
141 I A 0.0000
142 V A 0.9222
143 M A 0.0000
144 T A -0.6269
145 Q A -0.6660
146 S A -0.7042
147 P A -0.3209
148 A A -0.3308
149 T A -0.4237
150 L A -0.1575
151 S A -0.3141
152 L A -0.6617
153 S A -0.9935
154 P A -1.4959
155 G A -1.8129
156 E A -2.4154
157 R A -2.6942
158 A A 0.0000
159 T A -0.6675
160 L A 0.0000
161 S A -0.8896
162 A A 0.0000
163 R A -2.3139
164 A A 0.0000
165 S A -0.7265
166 Q A -1.1412
167 S A -1.0106
168 V A 0.0000
169 S A -0.3644
170 S A -0.1212
171 Y A 0.8666
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3917
179 P A -0.9195
180 G A -0.9622
181 C A -1.1175
182 Q A -1.5453
183 A A -1.1554
184 P A 0.0000
185 R A -1.4337
186 L A -0.7183
187 L A 0.0000
188 I A 0.0000
189 Y A -0.1853
190 D A -0.2771
191 A A 0.0000
192 S A -0.8938
193 N A -1.2586
194 R A -1.4769
195 A A -1.0026
196 T A -0.6638
197 G A -0.6512
198 I A 0.0000
199 P A -0.4495
200 A A -0.3906
201 R A -0.7243
202 F A 0.0000
203 S A -0.7022
204 G A -0.7055
205 S A -0.7962
206 G A -1.1202
207 S A -0.9276
208 G A -0.9737
209 T A -1.6624
210 D A -2.1859
211 F A 0.0000
212 T A -0.7927
213 L A 0.0000
214 T A -0.6038
215 I A 0.0000
216 S A -1.3587
217 S A -1.7405
218 L A 0.0000
219 E A -2.2675
220 P A -1.4686
221 E A -2.3040
222 D A 0.0000
223 F A -0.6695
224 A A 0.0000
225 V A -0.5748
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A 0.0007
233 S A -0.2370
234 T A -0.4072
235 P A -0.2567
236 L A 0.0000
237 T A 0.1415
238 F A 0.2161
239 G A 0.0000
240 G A -0.8206
241 G A -0.7768
242 T A 0.0000
243 K A -0.7659
244 A A 0.0000
245 E A -0.3946
246 I A 0.7269
247 K A -0.8786
248 A A -0.3469
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5022 5.2219 View CSV PDB
4.5 -0.5223 5.2142 View CSV PDB
5.0 -0.5456 5.1937 View CSV PDB
5.5 -0.5668 5.15 View CSV PDB
6.0 -0.5796 5.081 View CSV PDB
6.5 -0.5795 4.9958 View CSV PDB
7.0 -0.5667 4.9036 View CSV PDB
7.5 -0.5457 4.8089 View CSV PDB
8.0 -0.5201 4.7135 View CSV PDB
8.5 -0.4914 4.6181 View CSV PDB
9.0 -0.4602 4.5233 View CSV PDB