Project name: 126ea36093a0773

Status: done

Started: 2026-05-19 06:06:33
Chain sequence(s) A: VEFVRTGYGKDMVKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDIIPTDTIKNTVHVLAKFKGIKSIEAFAMNICEHFLSSFNHVIRAQVYVEEVPWKRFEKNGVKHVHAFIHTPTGTHFCEVEQMKSGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYHQGRDVDFEATWDTVRDIVLKKFAGPYDKGEYSPSVQKTLYDIQVLSLSRVPEIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGKITGTVKR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:07:48)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/126ea36093a0773/tmp/folded.pdb                (00:07:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:10:30)
Show buried residues

Minimal score value
-3.7915
Maximal score value
1.5828
Average score
-0.7734
Total score value
-220.4163

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
14 V A 1.2957
15 E A -0.3044
16 F A 0.7641
17 V A 1.1260
18 R A -0.9478
19 T A -0.3915
20 G A -0.6724
21 Y A -0.3166
22 G A -1.2799
23 K A -1.7036
24 D A -1.8635
25 M A -0.5700
26 V A 0.0000
27 K A -1.5648
28 V A -0.1092
29 L A 0.8887
30 H A -0.0148
31 I A -0.0950
32 Q A -2.2155
33 R A -3.4669
34 D A -3.3774
35 G A -2.5655
36 K A -2.5717
37 Y A -1.7150
38 H A -1.9569
39 S A -1.2125
40 I A -0.1860
41 K A -0.1097
42 E A 0.0701
43 V A 0.0000
44 A A 0.0000
45 T A 0.0000
46 S A -1.1350
47 V A 0.0000
48 Q A -1.0095
49 L A 0.0000
50 T A -0.4405
51 L A 0.0000
52 S A -0.5545
53 S A -0.2917
54 K A -0.2779
55 K A -0.7529
56 D A -0.8656
57 Y A 0.8246
58 L A 1.0379
59 H A -0.8179
60 G A -1.2212
61 D A -1.8577
62 N A -2.0851
63 S A -1.2952
64 D A -1.0062
65 I A -0.6060
66 I A 0.0000
67 P A -1.2227
68 T A -1.7201
69 D A -2.5832
70 T A -1.7997
71 I A 0.0000
72 K A -2.5139
73 N A -2.0792
74 T A -1.2348
75 V A 0.0000
76 H A -0.8767
77 V A -0.2512
78 L A 0.0000
79 A A 0.0000
80 K A -0.9503
81 F A 0.5533
82 K A -1.1764
83 G A 0.0000
84 I A 0.0000
85 K A -2.2179
86 S A -1.4568
87 I A 0.0000
88 E A 0.0000
89 A A -0.5476
90 F A 0.0000
91 A A 0.0000
92 M A -0.6684
93 N A -1.0915
94 I A 0.0000
95 C A 0.0000
96 E A -1.7898
97 H A -1.0555
98 F A 0.0000
99 L A -0.8846
100 S A -1.0378
101 S A -0.6765
102 F A -0.4258
103 N A -1.3091
104 H A -0.8344
105 V A 0.0000
106 I A -0.1313
107 R A -0.3375
108 A A 0.0000
109 Q A -0.6814
110 V A 0.0000
111 Y A -0.4259
112 V A 0.0000
113 E A -0.9080
114 E A -0.6264
115 V A -0.3738
116 P A -0.0965
117 W A 0.4604
118 K A -0.3406
119 R A -0.6282
120 F A -0.3578
121 E A -2.5962
122 K A -3.0335
123 N A -2.4466
124 G A -1.5652
125 V A -0.6426
126 K A -2.2665
127 H A -1.4558
128 V A -1.2161
129 H A -1.3421
130 A A -0.1265
131 F A 0.5799
132 I A 1.5828
133 H A 0.3649
134 T A 0.0204
135 P A -0.7576
136 T A -0.9043
137 G A 0.0000
138 T A -0.7516
139 H A 0.0000
140 F A 0.0000
141 C A 0.0000
142 E A -0.6313
143 V A 0.0000
144 E A -0.8840
145 Q A 0.0000
146 M A -0.0347
147 K A -0.9869
148 S A -0.5365
149 G A -0.3594
150 P A -0.6525
151 P A -0.5310
152 V A -0.2516
153 I A 0.0000
154 H A -0.6532
155 S A 0.0000
156 G A 0.0000
157 I A 0.0000
158 K A -1.5460
159 D A -2.2690
160 L A 0.0000
161 K A -2.0636
162 V A -0.3889
163 L A 0.6230
164 K A 0.1974
165 T A -0.2832
166 T A -1.1036
167 Q A -1.6277
168 S A 0.0000
169 G A 0.0000
170 F A -0.9183
171 E A -1.4640
172 G A -0.7151
173 F A 0.0801
174 I A 0.6653
175 K A -1.3088
176 D A -1.6826
177 Q A -1.1385
178 F A 0.6850
179 T A 0.1366
180 T A 0.0591
181 L A 0.8233
182 P A -0.4127
183 E A -1.6894
184 V A -1.5452
185 K A -2.6420
186 D A -2.7422
187 R A -1.5717
188 C A -0.1381
189 F A 0.0000
190 A A 0.0000
191 T A 0.0000
192 Q A -1.5641
193 V A 0.0000
194 Y A -0.6237
195 C A 0.0000
196 K A -0.6085
197 W A 0.0000
198 R A -1.3137
199 Y A 0.0000
200 H A -2.5008
201 Q A -2.8772
202 G A -2.5608
203 R A -3.7915
204 D A -3.3462
205 V A -2.6857
206 D A -2.7133
207 F A 0.0000
208 E A -2.4668
209 A A -1.7788
210 T A 0.0000
211 W A -1.8591
212 D A -2.7371
213 T A -2.1008
214 V A 0.0000
215 R A -2.1668
216 D A -2.9359
217 I A 0.0000
218 V A 0.0000
219 L A -1.3353
220 K A -2.4408
221 K A -1.7542
222 F A 0.0000
223 A A -0.8756
224 G A -1.6555
225 P A -1.3732
226 Y A -0.5418
227 D A -2.2479
228 K A -2.6712
229 G A -2.1497
230 E A -2.3540
231 Y A -0.9920
232 S A -1.0722
233 P A -1.1945
234 S A -0.9213
235 V A 0.0000
236 Q A -1.8327
237 K A -1.8532
238 T A 0.0000
239 L A 0.0000
240 Y A 0.6510
241 D A 0.1894
242 I A 0.0000
243 Q A 0.0000
244 V A 1.1283
245 L A 0.5853
246 S A 0.0000
247 L A 0.0000
248 S A -0.7171
249 R A -1.7565
250 V A 0.0000
251 P A -1.3615
252 E A -2.2076
253 I A 0.0000
254 E A -2.3643
255 D A -1.9026
256 M A 0.0000
257 E A -0.7241
258 I A 0.0000
259 S A -0.7037
260 L A 0.0000
261 P A 0.0000
262 N A -0.3977
263 I A -0.3386
264 H A 0.1991
265 Y A 1.3256
266 F A 1.1028
267 N A -1.2414
268 I A -0.3668
269 D A -1.5415
270 M A -0.3235
271 S A -0.4249
272 K A -1.3538
273 M A 0.2127
274 G A 0.1811
275 L A 1.2813
276 I A 1.1549
277 N A -1.0236
278 K A -2.8532
279 E A -3.4043
280 E A -2.4572
281 V A -0.3837
282 L A 0.3335
283 L A 1.3655
284 P A 0.3730
285 L A -0.3797
286 D A -2.0716
287 N A -1.9895
288 P A -1.3084
289 Y A -0.5752
290 G A -0.8152
291 K A -1.6508
292 I A -0.9418
293 T A -0.5820
294 G A -0.1422
295 T A -0.4405
296 V A -0.6903
297 K A -2.6181
298 R A -2.7745
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6403 3.5513 View CSV PDB
4.5 -0.7241 3.4725 View CSV PDB
5.0 -0.8198 3.387 View CSV PDB
5.5 -0.9097 3.3008 View CSV PDB
6.0 -0.9739 3.2169 View CSV PDB
6.5 -0.9988 3.1342 View CSV PDB
7.0 -0.9871 3.0989 View CSV PDB
7.5 -0.9512 3.0732 View CSV PDB
8.0 -0.8997 3.0904 View CSV PDB
8.5 -0.8334 3.1412 View CSV PDB
9.0 -0.7518 3.5883 View CSV PDB