Project name: KNL1 [mutate: AR2165A] [mutate: AV2165A]

Status: error

Started: 2026-03-30 01:23:16
Chain sequence(s) A: RTEELLDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQD
B: SLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQD
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage Yes
Dynamic mode No
Automated mutations No
Mutated residues AV2165A
Energy difference between WT (input) and mutated protein (by FoldX) 0.0 kcal/mol
Error log 
One of Aggrescan4D modules (PDB) encountered an error. 
AlphaCutter execution failed. This is probably because the input structure has gaps. If this structure wants to be cut to remove disordered regions, consider modeling it with AlphaFold using the original structure as a template. Otherwise, disable AlphaCutter's toggle.One of Aggrescan4D modules (PDB) encountered an error. 
AlphaCutter execution failed. This is probably because the input structure has gaps. If this structure wants to be cut to remove disordered regions, consider modeling it with AlphaFold using the original structure as a template. Otherwise, disable AlphaCutter's toggle.