Project name: S186D

Status: done

Started: 2026-08-16 07:23:55
Chain sequence(s) A: QCIQPGTGYNNGYFYSYWNDGHGGVTYCNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSADITVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log 
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:02)
Show buried residues
Minimal score value
-2.5521
Maximal score value
1.966
Average score
-0.4964
Total score value
-94.3116
Download the table (csv)

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.7927
2 C A 0.1236
3 I A -0.1959
4 Q A -0.8938
5 P A -0.6975
6 G A -0.4550
7 T A 0.0123
8 G A 0.4256
9 Y A 0.7979
10 N A -0.5709
11 N A -1.4529
12 G A -0.7794
13 Y A -0.2192
14 F A 0.0000
15 Y A 0.2356
16 S A 0.0000
17 Y A 0.0000
18 W A -0.0593
19 N A -0.8545
20 D A -1.2690
21 G A -1.4447
22 H A -1.6322
23 G A -1.4382
24 G A -1.1832
25 V A -1.0179
26 T A -0.4340
27 Y A 0.0000
28 C A -0.2940
29 N A 0.0000
30 G A -0.8754
31 P A -1.0545
32 G A -1.1002
33 G A 0.0000
34 Q A -0.8801
35 F A 0.0000
36 S A -0.7761
37 V A 0.0000
38 N A -1.5472
39 W A 0.0000
40 S A -1.1476
41 N A -1.1470
42 S A 0.0000
43 G A 0.0000
44 N A -0.0565
45 F A 0.0000
46 V A 0.2260
47 G A 0.0000
48 G A 0.0000
49 K A 0.0000
50 G A 0.0000
51 W A 0.0617
52 Q A -0.2872
53 P A -0.4752
54 G A 0.0000
55 T A -0.9322
56 K A -1.7828
57 N A -1.8076
58 K A -0.5471
59 V A 0.6503
60 I A 0.0000
61 N A -0.8618
62 F A 0.0000
63 S A -0.8549
64 G A -0.7834
65 S A -0.9619
66 Y A -1.0731
67 N A -1.8434
68 P A -1.5774
69 N A -1.7437
70 G A -0.6277
71 N A 0.0764
72 S A 0.0000
73 Y A 0.0366
74 L A 0.0000
75 S A 0.0000
76 V A 0.0000
77 Y A 0.0000
78 G A 0.0000
79 W A 0.0000
80 S A 0.0000
81 R A -1.5956
82 N A -1.9472
83 P A -1.2217
84 L A -0.3958
85 I A 0.0000
86 E A 0.0000
87 Y A 0.0000
88 Y A 0.0000
89 I A 0.0000
90 V A 0.0000
91 E A 0.0000
92 N A -0.9173
93 F A -0.3659
94 G A -0.6050
95 T A -0.2773
96 Y A 0.3113
97 N A -0.3027
98 P A -0.1760
99 S A 0.0000
100 T A -0.4895
101 G A -0.8198
102 A A -0.8750
103 T A -1.0391
104 K A -1.7624
105 L A -1.0083
106 G A -1.4236
107 E A -1.9362
108 V A -0.8997
109 T A -0.5166
110 S A 0.0000
111 D A -0.9595
112 G A -0.8961
113 S A 0.0000
114 V A -0.8856
115 Y A 0.0000
116 D A -1.3419
117 I A 0.0000
118 Y A -1.1109
119 R A -1.0277
120 T A -0.9066
121 Q A -1.0446
122 R A -0.9199
123 V A 0.3055
124 N A -1.1221
125 Q A -1.1585
126 P A -0.3606
127 S A 0.3260
128 I A 1.3180
129 I A 1.9660
130 G A 0.4733
131 T A -0.2240
132 A A -0.0882
133 T A -0.3316
134 F A 0.0000
135 Y A -0.0933
136 Q A 0.0000
137 Y A 0.0000
138 W A 0.0000
139 S A 0.0000
140 V A 0.0000
141 R A 0.0000
142 R A -2.5377
143 N A -2.5521
144 H A -2.0083
145 R A -1.3063
146 S A -0.7962
147 S A -0.7397
148 G A -0.7921
149 S A -0.4868
150 V A 0.0000
151 N A -0.5255
152 T A 0.0000
153 A A 0.0000
154 N A -1.2448
155 H A 0.0000
156 F A 0.0000
157 N A -2.1186
158 A A -1.6653
159 W A 0.0000
160 A A -1.3718
161 Q A -1.9948
162 Q A -1.7303
163 G A -1.2365
164 L A 0.0000
165 T A -0.7153
166 L A -0.6778
167 G A -1.0684
168 T A -1.0036
169 M A 0.0000
170 D A 0.0000
171 Y A 0.0000
172 Q A 0.0000
173 I A 0.0000
174 V A 0.0000
175 A A 0.0000
176 V A 0.0000
177 E A 0.0824
178 G A 0.0000
179 Y A 1.3783
180 F A 1.4974
181 S A 0.0000
182 S A -1.0556
183 G A -1.5639
184 S A -1.4114
185 A A 0.0000
186 D A -1.3258
187 I A 0.0000
188 T A -0.7859
189 V A 0.0000
190 S A -0.4272
Download PDB file
View in 3Dmol