Project name: 1329fa0f8e4fd1f

Status: done

Started: 2026-02-18 12:28:43
Chain sequence(s) A: DIVMTQSHKFMSTSLGDRVNITCKASQDVGTAVVWYQQTSGQSPKLLIYWASTRHIGVPDRFTGSGSGTDLTLTISNVQSEDLADYFCQQYHTSPYTFGGGTKLEIK
B: DVKLVESGGGLVKPGGSLRLSCEASGFTFSTYTMSWVRQTPEKRLEWVATISNGGRHTYYPDSVEGRFTISRDNARSTLYLQMRGLKSEDTAIYYCTKLYTGGFWFFDVWGAGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:37)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1329fa0f8e4fd1f/tmp/folded.pdb                (00:03:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:47)
Show buried residues

Minimal score value
-3.3171
Maximal score value
1.4954
Average score
-0.7114
Total score value
-161.4959

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.5747
2 I A 0.0000
3 V A 0.7233
4 M A 0.0000
5 T A -0.6809
6 Q A 0.0000
7 S A -1.1381
8 H A -1.3908
9 K A -1.5379
10 F A 0.1930
11 M A -0.3473
12 S A -0.4420
13 T A 0.0000
14 S A -1.1325
15 L A -0.6698
16 G A -1.8625
17 D A -2.9471
18 R A -3.3171
19 V A 0.0000
20 N A -1.6890
21 I A 0.0000
22 T A -1.1711
23 C A 0.0000
24 K A -2.0250
25 A A 0.0000
26 S A -1.2583
27 Q A -2.5286
28 D A -2.9922
29 V A 0.0000
30 G A -1.2871
31 T A -0.6416
32 A A 0.0000
33 V A 0.0000
34 V A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 T A -1.1563
40 S A -0.8091
41 G A -1.1505
42 Q A -1.7212
43 S A -1.0185
44 P A 0.0000
45 K A -1.6249
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.1256
50 W A 0.3308
51 A A 0.0000
52 S A -0.4551
53 T A -0.2617
54 R A -0.8627
55 H A 0.0259
56 I A 1.4954
57 G A 0.1536
58 V A -0.3890
59 P A -0.9749
60 D A -2.1487
61 R A -1.7534
62 F A 0.0000
63 T A -0.9327
64 G A 0.0000
65 S A -0.5839
66 G A -1.0150
67 S A -1.2505
68 G A -1.8298
69 T A -2.2284
70 D A -2.4148
71 L A 0.0000
72 T A -1.0130
73 L A 0.0000
74 T A -1.1642
75 I A 0.0000
76 S A -2.4278
77 N A -2.5904
78 V A 0.0000
79 Q A -1.5370
80 S A -1.0588
81 E A -1.9620
82 D A 0.0000
83 L A -0.6559
84 A A 0.0000
85 D A -0.7480
86 Y A 0.0000
87 F A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 Y A 0.0000
92 H A -1.3050
93 T A -1.1870
94 S A -0.6749
95 P A -0.7939
96 Y A 0.0000
97 T A -0.2554
98 F A 0.0000
99 G A 0.0000
100 G A -1.3803
101 G A 0.0000
102 T A 0.0000
103 K A -0.9926
104 L A 0.0000
105 E A -0.9302
106 I A 0.0527
107 K A -1.3376
1 D B -2.0925
2 V B -1.2214
3 K B -1.9553
4 L B 0.0000
5 V B 0.1453
6 E B 0.0000
7 S B -0.6374
8 G B -0.9541
9 G B -0.3707
10 G B 0.3029
11 L B 1.1449
12 V B -0.2269
13 K B -1.8213
14 P B -2.0957
15 G B -1.8084
16 G B -1.3958
17 S B -1.6929
18 L B -1.1507
19 R B -2.2660
20 L B 0.0000
21 S B -0.8600
22 C B 0.0000
23 E B -2.0784
24 A B 0.0000
25 S B -1.4914
26 G B -1.2432
27 F B -0.3906
28 T B -0.0330
29 F B 0.0000
30 S B -0.7446
31 T B -0.2930
32 Y B -0.0577
33 T B -0.3742
34 M B 0.0000
35 S B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B 0.0000
39 Q B 0.0000
40 T B -1.5220
41 P B -1.6706
42 E B -2.6243
43 K B -2.2921
44 R B -1.7972
45 L B 0.0000
46 E B -0.8161
47 W B 0.0000
48 V B 0.0000
49 A B 0.0000
50 T B 0.0000
51 I B 0.0000
52 S B -1.2007
53 N B -1.3644
54 G B -1.4666
55 G B -1.8574
56 R B -2.5908
57 H B -1.9579
58 T B -0.6221
59 Y B 0.0319
60 Y B -0.6401
61 P B -1.5427
62 D B -2.5373
63 S B -1.8434
64 V B 0.0000
65 E B -2.7013
66 G B -2.0783
67 R B -2.1378
68 F B 0.0000
69 T B -0.9817
70 I B 0.0000
71 S B -0.6747
72 R B -0.9409
73 D B -1.4945
74 N B -1.5079
75 A B -1.2274
76 R B -2.4708
77 S B -1.7644
78 T B 0.0000
79 L B 0.0000
80 Y B -0.7756
81 L B 0.0000
82 Q B -1.5050
83 M B 0.0000
84 R B -2.7467
85 G B -1.9971
86 L B 0.0000
87 K B -2.5232
88 S B -1.9746
89 E B -2.3620
90 D B 0.0000
91 T B -0.6567
92 A B 0.0000
93 I B 0.2376
94 Y B 0.0000
95 Y B 0.0000
96 C B 0.0000
97 T B 0.0000
98 K B 0.0000
99 L B 0.0000
100 Y B 0.3319
101 T B -0.0461
102 G B -0.2151
103 G B -0.0446
104 F B 0.7134
105 W B 0.3752
106 F B 0.0000
107 F B 0.0000
108 D B -0.3225
109 V B -0.1988
110 W B 0.0000
111 G B 0.0000
112 A B -0.1930
113 G B 0.0793
114 T B 0.0607
115 T B 0.1649
116 V B 0.0000
117 T B -0.1342
118 V B 0.0000
119 S B -0.8387
120 S B -0.8410
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7651 2.2338 View CSV PDB
4.5 -0.8177 2.2415 View CSV PDB
5.0 -0.8771 2.2587 View CSV PDB
5.5 -0.9322 2.2859 View CSV PDB
6.0 -0.9733 2.3132 View CSV PDB
6.5 -0.9948 2.3313 View CSV PDB
7.0 -0.9987 2.3422 View CSV PDB
7.5 -0.9922 2.3462 View CSV PDB
8.0 -0.9795 2.3475 View CSV PDB
8.5 -0.9602 2.3479 View CSV PDB
9.0 -0.9324 2.3479 View CSV PDB