Project name: 142974a5a301bb3

Status: done

Started: 2026-03-12 18:07:01
Chain sequence(s) A: MHHHHHHFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTAEAAAKEAAAKAEPRIQKEYYYNLHENNSQANHNKFHEMPEYDDQLPDFPHKQLEEEQNPFHKLSEVLNSGSVVPLWLVNPIYYVLELFPRAISYYFN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/142974a5a301bb3/tmp/folded.pdb                (00:05:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:14)
Show buried residues

Minimal score value
-3.9331
Maximal score value
4.1829
Average score
-0.7493
Total score value
-180.5706

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1758
2 H A -1.3835
3 H A -2.1062
4 H A -2.5510
5 H A -2.6390
6 H A -2.5394
7 H A -2.3853
8 F A -1.6370
9 D A -2.5492
10 A A -1.9459
11 S A -2.1108
12 N A -2.3714
13 F A 0.0000
14 K A -2.3927
15 D A -1.3279
16 F A 0.0000
17 S A -0.8474
18 S A -1.3135
19 I A 0.0000
20 A A -0.5733
21 S A -0.8576
22 A A -1.0283
23 S A -0.6763
24 S A 0.0000
25 S A -0.0893
26 W A 0.0000
27 Q A -0.7950
28 N A 0.0000
29 Q A -1.6946
30 S A -1.1936
31 G A -1.0198
32 S A 0.0000
33 T A -0.6291
34 M A 0.0000
35 I A 0.0268
36 I A 0.0000
37 Q A -1.5945
38 V A 0.0000
39 D A -0.9125
40 S A 0.2359
41 F A 1.0782
42 G A -0.6804
43 N A -1.1831
44 V A 0.0000
45 S A -1.2130
46 G A -0.7749
47 Q A -0.7641
48 Y A 0.0000
49 V A 0.0000
50 N A 0.0000
51 R A -1.9806
52 A A -1.6335
53 Q A -1.8143
54 G A -1.3288
55 T A -1.0149
56 G A -1.2836
57 C A 0.0000
58 Q A -2.4039
59 N A -2.1715
60 S A -1.4315
61 P A -1.1281
62 Y A 0.0000
63 P A -0.8979
64 L A 0.0000
65 T A -0.9683
66 G A -1.2144
67 R A -1.9612
68 V A 0.0000
69 N A -1.1891
70 G A -0.8558
71 T A -0.1428
72 F A 0.8797
73 I A 0.0000
74 A A -0.4499
75 F A 0.0000
76 S A -0.6244
77 V A 0.0000
78 G A -1.1537
79 W A 0.0000
80 N A -2.5661
81 N A -1.7976
82 S A -1.0941
83 T A -1.3062
84 E A -2.1496
85 N A -2.5395
86 C A -1.6703
87 N A -2.2389
88 S A -1.0857
89 A A -0.5664
90 T A 0.0000
91 G A -0.6309
92 W A 0.0000
93 T A -0.1049
94 G A 0.0000
95 Y A 1.0352
96 A A 0.0000
97 Q A -0.5654
98 V A -1.2740
99 N A -1.8184
100 G A -1.7194
101 N A -2.2628
102 N A -1.8445
103 T A 0.0000
104 E A 0.0000
105 I A 0.0000
106 V A 0.3043
107 T A 0.0000
108 S A -0.9205
109 W A -1.0500
110 N A -1.2092
111 L A 0.0000
112 A A -0.2148
113 Y A -0.6662
114 E A -1.9334
115 G A -1.1459
116 G A -1.1189
117 S A -0.9323
118 G A -1.1050
119 P A -0.8257
120 A A -0.0221
121 I A 0.9391
122 E A -0.5352
123 Q A -1.6937
124 G A -1.6571
125 Q A -1.7253
126 D A 0.0000
127 T A -0.6834
128 F A 0.0000
129 Q A -0.9683
130 Y A 0.0000
131 V A 0.3817
132 P A -0.5044
133 T A -0.8321
134 T A -1.5506
135 E A -3.1281
136 N A -2.7905
137 K A -2.7184
138 S A -1.0093
139 L A 0.4613
140 L A 0.3947
141 K A -2.0603
142 D A -2.4719
143 T A -1.2076
144 A A -1.7375
145 E A -3.2923
146 A A -2.4189
147 A A -2.0524
148 A A -2.2397
149 K A -3.1747
150 E A -3.2076
151 A A -2.2610
152 A A -2.0000
153 A A -2.5268
154 K A -2.9406
155 A A -2.2140
156 E A -2.5568
157 P A -2.4293
158 R A -2.7515
159 I A -0.6117
160 Q A -1.1647
161 K A -2.1816
162 E A -1.5376
163 Y A 0.5131
164 Y A 0.4457
165 Y A -0.2370
166 N A -1.4530
167 L A -0.7533
168 H A -2.1038
169 E A -3.1915
170 N A -3.2555
171 N A -3.3551
172 S A -2.8299
173 Q A -2.8185
174 A A -2.1577
175 N A -2.8576
176 H A -2.6092
177 N A -2.6178
178 K A -2.4935
179 F A -0.3404
180 H A -1.4313
181 E A -1.8301
182 M A -0.2332
183 P A -1.1023
184 E A -2.0097
185 Y A -1.0142
186 D A -2.6086
187 D A -2.7764
188 Q A -2.0334
189 L A -0.1689
190 P A -0.4166
191 D A -0.9453
192 F A 0.5975
193 P A -0.9829
194 H A -1.7969
195 K A -2.4447
196 Q A -2.3654
197 L A -1.2964
198 E A -3.1876
199 E A -3.8736
200 E A -3.9331
201 Q A -3.5630
202 N A -2.4489
203 P A -0.9502
204 F A 0.4340
205 H A -1.3454
206 K A -1.3713
207 L A 0.7742
208 S A -0.0869
209 E A -1.2215
210 V A 0.9478
211 L A 1.2733
212 N A -0.7277
213 S A -0.2223
214 G A 0.0980
215 S A 1.0684
216 V A 2.6828
217 V A 3.6262
218 P A 2.9557
219 L A 3.6370
220 W A 3.5784
221 L A 3.7251
222 V A 3.6133
223 N A 2.2527
224 P A 2.8519
225 I A 3.5785
226 Y A 3.0690
227 Y A 3.1529
228 V A 4.1829
229 L A 3.7280
230 E A 1.9713
231 L A 2.8080
232 F A 2.9614
233 P A 1.1658
234 R A 0.0281
235 A A 1.4504
236 I A 1.9174
237 S A 1.1487
238 Y A 1.8451
239 Y A 2.4829
240 F A 2.4994
241 N A 0.5548
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.23 7.1987 View CSV PDB
4.5 -0.3133 7.1987 View CSV PDB
5.0 -0.4136 7.1987 View CSV PDB
5.5 -0.5066 7.1987 View CSV PDB
6.0 -0.5681 7.1987 View CSV PDB
6.5 -0.5873 7.1987 View CSV PDB
7.0 -0.5734 7.1987 View CSV PDB
7.5 -0.5425 7.1987 View CSV PDB
8.0 -0.5034 7.1987 View CSV PDB
8.5 -0.4572 7.1985 View CSV PDB
9.0 -0.4042 7.1981 View CSV PDB