Project name: f05 mutant 5 antibody

Status: done

Started: 2026-03-17 06:29:15
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRVSQNVSSNLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVKLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSAISASGATTYYADPVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:00)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:06)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/14c70ae598adfcc/tmp/folded.pdb                (00:02:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:51)
Show buried residues

Minimal score value
-2.9582
Maximal score value
1.4901
Average score
-0.7313
Total score value
-180.6286

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8776
2 I A 0.0000
3 V A 0.7031
4 L A 0.0000
5 T A -0.6513
6 Q A -0.7949
7 S A -0.7301
8 P A -0.3113
9 A A -0.3090
10 T A -0.3712
11 L A -0.1476
12 S A -0.5817
13 L A -1.1425
14 S A -1.7102
15 P A -1.9660
16 G A -1.7561
17 E A -2.4184
18 R A -2.7035
19 A A 0.0000
20 T A -0.6674
21 L A 0.0000
22 S A -0.9645
23 C A 0.0000
24 R A -2.5185
25 V A 0.0000
26 S A -1.2604
27 Q A -2.5028
28 N A -2.5793
29 V A 0.0000
30 S A -1.1517
31 S A -0.8853
32 N A -1.1454
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.3084
40 P A -0.8819
41 G A -1.3462
42 Q A -1.8613
43 A A -1.3161
44 P A 0.0000
45 R A -1.2434
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 D A -0.8382
51 T A 0.0000
52 S A -1.0691
53 N A -1.5079
54 R A -1.4762
55 A A 0.0000
56 T A -0.5900
57 G A -0.5542
58 I A -0.5639
59 P A -0.3634
60 A A -0.3339
61 R A -0.7878
62 F A 0.0000
63 S A -0.6337
64 G A -0.7296
65 S A -0.8307
66 G A -1.1645
67 P A -1.0990
68 G A -1.6345
69 T A -2.1269
70 D A -2.4725
71 F A 0.0000
72 T A -0.8309
73 L A 0.0000
74 T A -0.6033
75 I A 0.0000
76 S A -1.3746
77 S A -1.7252
78 L A 0.0000
79 E A -2.0131
80 P A -2.0024
81 E A -2.3073
82 D A 0.0000
83 F A -0.6417
84 A A 0.0000
85 V A -0.1179
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A -1.1471
92 R A -2.4082
93 N A -2.2716
94 W A -0.9840
95 P A -1.0594
96 L A 0.0000
97 T A -0.4129
98 F A 0.1355
99 G A 0.0000
100 G A -0.7665
101 G A -0.6832
102 T A 0.0000
103 K A -0.7161
104 V A 0.0000
105 E A -0.8943
106 I A -1.6441
107 K A -2.0829
108 G A -1.6541
109 G A -1.7535
110 G A -1.3198
111 G A -1.3072
112 S A -1.3549
113 G A -1.4511
114 G A -1.5694
115 G A -1.2040
116 G A -1.1833
117 S A -1.0431
118 G A -1.4303
119 G A -1.4852
120 G A -1.4738
121 G A -1.5993
122 S A -1.7551
123 E A -2.7131
124 V A -1.6478
125 K A -2.1057
126 L A 0.0000
127 V A -0.1130
128 E A 0.0000
129 S A -0.4466
130 G A -0.7961
131 G A 0.0580
132 G A 0.5765
133 L A 1.3060
134 V A 0.0000
135 Q A -1.5370
136 P A -1.8720
137 G A -1.6236
138 G A -1.1168
139 S A -1.3784
140 L A -0.8855
141 R A -1.9664
142 L A 0.0000
143 S A -0.5221
144 C A 0.0000
145 A A -0.5174
146 A A 0.0000
147 S A -1.0337
148 G A -1.3752
149 F A -0.7788
150 T A -0.6374
151 F A 0.0000
152 S A -1.5389
153 R A -2.0478
154 Y A -0.8993
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6415
162 A A -1.0435
163 P A -0.8343
164 G A -1.4482
165 K A -2.2698
166 G A -1.3646
167 L A 0.0000
168 E A -0.9633
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 A A 0.0000
173 I A 0.0000
174 S A -0.2030
175 A A -0.8138
176 S A -0.7878
177 G A -0.4567
178 A A -0.1405
179 T A 0.0021
180 T A 0.2460
181 Y A 0.3131
182 Y A -0.5361
183 A A 0.0000
184 D A -2.5987
185 P A -1.8294
186 V A 0.0000
187 K A -2.5488
188 G A -1.7986
189 R A -1.6181
190 F A 0.0000
191 T A -0.7746
192 I A 0.0000
193 S A -0.4177
194 R A -1.0181
195 D A -1.6412
196 N A -1.9145
197 S A -1.6069
198 K A -2.3977
199 N A -1.7461
200 T A -1.1205
201 L A 0.0000
202 Y A -0.5292
203 L A 0.0000
204 Q A -1.1925
205 M A 0.0000
206 N A -1.6496
207 S A -1.4980
208 L A 0.0000
209 R A -2.9582
210 A A -2.0397
211 E A -2.4530
212 D A 0.0000
213 T A -0.5307
214 A A 0.0000
215 V A 0.7107
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A 0.0000
222 Q A 0.0000
223 D A -1.9817
224 F A -0.7622
225 D A -1.3832
226 I A 0.3440
227 L A 1.4335
228 T A 0.7329
229 G A 0.1847
230 Y A 0.5099
231 L A 0.7991
232 N A 0.0000
233 W A 0.0000
234 F A 0.0000
235 D A -0.8038
236 P A -1.1965
237 W A 0.0000
238 G A 0.0000
239 Q A -1.5164
240 G A -0.2912
241 T A 0.3648
242 L A 1.4901
243 V A 0.0000
244 T A 0.1681
245 V A 0.0000
246 S A -0.9007
247 S A -0.7827
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5775 2.5531 View CSV PDB
4.5 -0.615 2.4769 View CSV PDB
5.0 -0.66 2.388 View CSV PDB
5.5 -0.705 2.2941 View CSV PDB
6.0 -0.7421 2.1985 View CSV PDB
6.5 -0.7643 2.1623 View CSV PDB
7.0 -0.7701 2.1623 View CSV PDB
7.5 -0.7646 2.1623 View CSV PDB
8.0 -0.7526 2.1623 View CSV PDB
8.5 -0.7354 2.1623 View CSV PDB
9.0 -0.7129 2.1623 View CSV PDB