Project name: 178572fe89a9934

Status: done

Started: 2026-05-25 13:29:28
Chain sequence(s) A: PMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:53)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/178572fe89a9934/tmp/folded.pdb                (00:05:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:30)
Show buried residues

Minimal score value
-3.8994
Maximal score value
0.6409
Average score
-1.0272
Total score value
-270.145

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
20 P A -0.8724
21 M A 0.0000
22 R A -0.8703
23 I A 0.0000
24 C A 0.0000
25 S A 0.0000
26 F A 0.0000
27 N A 0.0000
28 V A 0.0000
29 R A -1.2401
30 S A -1.0957
31 F A 0.0000
32 G A -2.2540
33 E A -3.1515
34 S A -2.1418
35 K A -2.7581
36 Q A -3.1544
37 E A -3.6384
38 D A -3.6620
39 K A -3.8994
40 N A -3.6470
41 A A 0.0000
42 M A 0.0000
43 D A -3.2074
44 V A 0.0000
45 I A 0.0000
46 V A 0.0000
47 K A -1.7911
48 V A 0.0000
49 I A 0.0000
50 K A -1.9904
51 R A -1.4174
52 C A 0.0000
53 D A -1.0715
54 I A 0.0000
55 I A 0.0000
56 L A 0.0000
57 V A 0.0000
58 M A 0.0000
59 E A -0.8904
60 I A 0.0000
61 K A -2.0427
62 D A -2.4958
63 S A -2.0770
64 N A -2.4324
65 N A -2.3661
66 R A 0.0000
67 I A 0.0000
68 C A -0.1372
69 P A -0.3592
70 I A 0.0000
71 L A 0.2503
72 M A 0.2037
73 E A -1.3353
74 K A 0.0000
75 L A -1.1751
76 N A -2.4502
77 R A -3.4657
78 N A -3.3256
79 S A -2.9251
80 R A -3.1908
81 R A -3.2826
82 G A -2.5041
83 I A -1.9314
84 T A -1.7182
85 Y A 0.0000
86 N A -0.7069
87 Y A 0.2662
88 V A 0.6409
89 I A 0.3492
90 S A 0.0000
91 S A -1.1697
92 R A -2.5691
93 L A 0.0000
94 G A -1.8796
95 R A -2.5972
96 N A -2.2037
97 T A -0.8300
98 Y A -0.2691
99 K A -1.8265
100 E A 0.0000
101 Q A -1.2204
102 Y A 0.0000
103 A A 0.0000
104 F A 0.0000
105 L A 0.0000
106 Y A 0.0000
107 K A -1.5044
108 E A -2.0885
109 K A -2.3710
110 L A -1.2958
111 V A 0.0000
112 S A -1.0918
113 V A -0.6296
114 K A -1.4916
115 R A -2.0851
116 S A -0.9015
117 Y A -0.5756
118 H A -0.5071
119 Y A 0.0000
120 H A -1.7594
121 D A -2.1849
122 Y A -0.7324
123 Q A -2.2654
124 D A -3.1212
125 G A -2.9309
126 D A -3.3196
127 A A -2.4289
128 D A -2.8025
129 V A -1.4356
130 F A 0.0000
131 S A -1.2422
132 R A 0.0000
133 E A -0.8400
134 P A 0.0000
135 F A 0.0000
136 V A 0.0000
137 V A 0.0000
138 W A 0.0000
139 F A 0.0000
140 Q A -1.3034
141 S A 0.0000
142 P A -1.3370
143 H A -1.4325
144 T A 0.0000
145 A A -1.1840
146 V A 0.0000
147 K A -2.0586
148 D A -1.4755
149 F A 0.0000
150 V A 0.0000
151 I A 0.0000
152 I A 0.0000
153 P A 0.0000
154 L A 0.0000
155 H A 0.0000
156 T A 0.0000
157 T A -0.5220
158 P A -0.8215
159 E A -1.9169
160 T A -1.2307
161 S A 0.0000
162 V A -1.1819
163 K A -2.0241
164 E A 0.0000
165 I A 0.0000
166 D A 0.0000
167 E A -0.8968
168 L A 0.0000
169 V A -0.5882
170 E A -1.2783
171 V A 0.0000
172 Y A -0.9792
173 T A -1.4384
174 D A -2.1787
175 V A 0.0000
176 K A -3.2389
177 H A -2.9237
178 R A -3.1935
179 W A 0.0000
180 K A -2.9472
181 A A 0.0000
182 E A -2.9360
183 N A 0.0000
184 F A 0.0000
185 I A 0.0000
186 F A 0.0000
187 M A 0.0000
188 G A 0.0000
189 D A 0.0000
190 F A 0.0000
191 N A 0.0000
192 A A 0.0000
193 G A -0.6243
194 C A 0.0564
195 S A -0.1490
196 Y A -0.0792
197 V A 0.0000
198 P A -1.0944
199 K A -2.8670
200 K A -3.0995
201 A A -2.1076
202 W A -2.3090
203 K A -3.1505
204 N A -2.8118
205 I A 0.0000
206 R A -2.0963
207 L A 0.0000
208 R A -1.5791
209 T A -1.7588
210 D A -1.4431
211 P A -1.4567
212 R A -2.1815
213 F A 0.0000
214 V A -0.1469
215 W A -0.1533
216 L A 0.0000
217 I A 0.0000
218 G A -1.5321
219 D A -2.8446
220 Q A -2.6013
221 E A -1.9469
222 D A -1.8998
223 T A 0.0000
224 T A 0.0000
225 V A 0.0000
226 K A -2.2296
227 K A -2.5502
228 S A -1.5794
229 T A -1.5006
230 N A -2.2787
231 C A 0.0000
232 A A 0.0000
233 Y A -0.2196
234 D A 0.0000
235 R A 0.0000
236 I A 0.0000
237 V A 0.0000
238 L A 0.0000
239 R A -1.3297
240 G A -2.0152
241 Q A -2.5193
242 E A -2.7584
243 I A 0.0000
244 V A -0.6439
245 S A -0.9298
246 S A 0.0000
247 V A -0.6426
248 V A -0.7285
249 P A -1.1628
250 K A -1.9199
251 S A 0.0000
252 N A -0.9878
253 S A -0.5862
254 V A 0.0978
255 F A -0.0676
256 D A -0.8962
257 F A 0.0000
258 Q A -1.9377
259 K A -2.4098
260 A A -1.3015
261 Y A -1.2446
262 K A -2.3699
263 L A -1.7217
264 T A -1.6053
265 E A -2.3715
266 E A -2.8403
267 E A -2.7091
268 A A 0.0000
269 L A -1.8788
270 D A -2.8577
271 V A 0.0000
272 S A 0.0000
273 D A -0.8865
274 H A 0.0000
275 F A 0.0000
276 P A 0.0000
277 V A 0.0000
278 E A 0.0000
279 F A 0.0000
280 K A -1.1339
281 L A 0.0000
282 Q A -1.3305
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.2001 0.975 View CSV PDB
4.5 -1.2593 0.946 View CSV PDB
5.0 -1.3295 0.963 View CSV PDB
5.5 -1.3965 0.9813 View CSV PDB
6.0 -1.4434 0.9966 View CSV PDB
6.5 -1.4573 1.013 View CSV PDB
7.0 -1.4391 1.0349 View CSV PDB
7.5 -1.3999 1.0613 View CSV PDB
8.0 -1.3491 1.09 View CSV PDB
8.5 -1.2898 1.1202 View CSV PDB
9.0 -1.2221 1.2928 View CSV PDB