Project name: IgGM99_protenix

Status: done

Started: 2026-06-14 15:54:33
Chain sequence(s) A: EVQLVESGGGLEQPGGSLRLSCAGSGFTFSNYLLDWVRQAPGKGLEWVSSIRGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAREAASTGKTNYYGIDVWGQGTTVTVSSAS
B: DIVMTQSPLSLPVTPGEPASISCRSSQDVRSYLAWYLQKSGQSPQLLIYGASSLASGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYCMQYYGSSYTFGQGTKLEIKRTV
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:46)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/17fe1a5e0b55126/tmp/folded.pdb                (00:01:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:01)
Show buried residues

Minimal score value
-3.1222
Maximal score value
1.1591
Average score
-0.7334
Total score value
-173.8137

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.1435
2 V A -1.6152
3 Q A -1.3640
4 L A 0.0000
5 V A 1.1591
6 E A 0.0000
7 S A -0.3957
8 G A -1.0014
9 G A -0.5147
10 G A 0.0725
11 L A 0.7968
12 E A -0.5643
13 Q A -1.5972
14 P A -1.7577
15 G A -1.5774
16 G A -1.2054
17 S A -1.4760
18 L A -1.2421
19 R A -2.3689
20 L A 0.0000
21 S A -0.4020
22 C A 0.0000
23 A A -0.0849
24 G A 0.0000
25 S A -1.0568
26 G A -1.3529
27 F A -0.9803
28 T A -0.6439
29 F A 0.0000
30 S A -1.3145
31 N A -1.5670
32 Y A 0.0000
33 L A -0.9556
34 L A 0.0000
35 D A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8895
40 A A -1.2756
41 P A -1.0352
42 G A -1.4793
43 K A -2.3830
44 G A -1.5143
45 L A 0.0000
46 E A -0.9777
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 I A 0.0000
52 R A -1.7710
53 G A -1.6093
54 S A -1.2323
55 G A -1.2330
56 G A -1.0173
57 S A -0.7061
58 T A -0.2311
59 Y A 0.0463
60 Y A -0.6001
61 A A -1.4705
62 D A -2.5756
63 S A -1.7019
64 V A 0.0000
65 K A -2.4786
66 G A -1.8219
67 R A -1.7239
68 F A 0.0000
69 T A -1.0051
70 I A 0.0000
71 S A -0.7263
72 R A -1.2777
73 D A -1.6559
74 N A -1.8313
75 S A -1.6133
76 K A -2.3953
77 N A -1.7826
78 T A -0.9710
79 L A 0.0000
80 Y A -0.6387
81 L A 0.0000
82 Q A -1.7559
83 M A 0.0000
84 N A -2.1687
85 S A -1.5115
86 L A 0.0000
87 R A -2.3764
88 A A -1.7606
89 E A -2.2132
90 D A 0.0000
91 T A -0.7208
92 A A 0.0000
93 V A -0.0289
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 R A 0.0000
100 E A -1.6679
101 A A -1.1605
102 A A -0.7523
103 S A -0.9869
104 T A -0.7852
105 G A -1.4332
106 K A -2.0631
107 T A -1.1015
108 N A -0.6185
109 Y A -0.0913
110 Y A 0.6884
111 G A 0.0000
112 I A 0.0000
113 D A -0.7605
114 V A -0.7438
115 W A -0.2845
116 G A 0.0000
117 Q A -1.1659
118 G A 0.0000
119 T A -0.1846
120 T A -0.0961
121 V A 0.0000
122 T A -0.2337
123 V A 0.0000
124 S A -0.8936
125 S A -0.7973
126 A A -0.2681
127 S A -0.2883
1 D B -1.6489
2 I B -0.2198
3 V B 0.7479
4 M B 0.0000
5 T B -0.5467
6 Q B 0.0000
7 S B -0.4100
8 P B 0.1271
9 L B 0.6185
10 S B 0.0523
11 L B -0.1816
12 P B -1.1141
13 V B 0.0000
14 T B -1.8253
15 P B -2.1896
16 G B -2.1377
17 E B -2.3539
18 P B -2.0814
19 A B 0.0000
20 S B -0.6963
21 I B 0.0000
22 S B -0.9123
23 C B 0.0000
24 R B -2.4419
25 S B 0.0000
26 S B -1.1197
27 Q B -2.1606
28 D B -2.4480
29 V B 0.0000
30 R B -2.3577
31 S B -1.1139
32 Y B -0.0254
33 L B 0.0000
34 A B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 L B 0.0000
38 Q B -0.8328
39 K B -1.4253
40 S B -0.9431
41 G B -1.4853
42 Q B -2.1090
43 S B -1.3868
44 P B 0.0000
45 Q B -1.1703
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.3435
50 G B 0.0000
51 A B 0.0000
52 S B -0.1977
53 S B 0.1035
54 L B 0.0090
55 A B 0.0000
56 S B -0.4044
57 G B -0.7456
58 V B 0.0000
59 P B -1.1968
60 D B -2.0412
61 R B -2.1300
62 F B 0.0000
63 S B -0.9515
64 G B -0.4628
65 S B -0.7381
66 G B -1.2639
67 S B -1.6843
68 G B -2.2016
69 T B -2.3896
70 D B -2.5402
71 F B 0.0000
72 T B -1.0283
73 L B 0.0000
74 K B -1.4584
75 I B 0.0000
76 S B -2.2471
77 R B -3.1222
78 V B 0.0000
79 E B -2.5474
80 A B -1.3885
81 E B -2.1338
82 D B 0.0000
83 V B -0.4113
84 G B -0.4417
85 F B 0.2797
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 M B 0.0000
90 Q B 0.0000
91 Y B 0.0000
92 Y B 0.5009
93 G B -0.3045
94 S B -0.2864
95 S B -0.4332
96 Y B 0.1639
97 T B 0.0670
98 F B 0.0882
99 G B 0.0000
100 Q B -0.9774
101 G B 0.0000
102 T B 0.0000
103 K B -0.4620
104 L B 0.0000
105 E B -1.0705
106 I B -1.4982
107 K B -2.2349
108 R B -2.0797
109 T B -0.4300
110 V B 0.8809
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7188 1.2626 View CSV PDB
4.5 -0.7661 1.2423 View CSV PDB
5.0 -0.8208 1.2134 View CSV PDB
5.5 -0.8743 1.1807 View CSV PDB
6.0 -0.9175 1.1495 View CSV PDB
6.5 -0.9425 1.1247 View CSV PDB
7.0 -0.949 1.1099 View CSV PDB
7.5 -0.9433 1.1113 View CSV PDB
8.0 -0.9304 1.2657 View CSV PDB
8.5 -0.9111 1.4242 View CSV PDB
9.0 -0.8845 1.5835 View CSV PDB