Project name: 5866f21db489172 [mutate: FY175A, YK200A, FK207A, FK222A]

Status: done

Started: 2025-03-21 11:06:10
Chain sequence(s) A: MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPAEPIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTQPPPTSSDTLDLDFQAHGTISFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues FK207A,FY175A,YK200A,FK222A
Energy difference between WT (input) and mutated protein (by FoldX) 3.97424 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:26)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:12)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/180fc28ddc1ae64/tmp/folded.pdb                (00:02:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:25)
Show buried residues

Minimal score value
-4.2586
Maximal score value
4.7386
Average score
-0.7888
Total score value
-190.1089

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.7953
2 S A 1.9128
3 M A 2.8638
4 L A 3.5772
5 F A 4.3767
6 Y A 4.0716
7 T A 3.3834
8 L A 4.6433
9 I A 4.7386
10 T A 3.3402
11 A A 3.3441
12 F A 4.3190
13 L A 3.6445
14 I A 3.4125
15 G A 1.9718
16 V A 2.0730
17 Q A 0.0353
18 A A -0.3235
19 E A -1.7027
20 P A -0.9244
21 Y A 0.1301
22 T A -0.7412
23 D A -1.6853
24 S A -1.1813
25 N A -1.3732
26 V A 0.1029
27 P A -1.1248
28 E A -2.4434
29 G A -1.7590
30 D A -2.4213
31 S A -1.0959
32 V A 0.4937
33 P A -0.5742
34 E A -1.7109
35 A A -1.2279
36 H A -1.4438
37 W A -1.2848
38 T A -1.9085
39 K A -2.6860
40 L A 0.0000
41 Q A -2.1924
42 H A -2.1661
43 S A -1.5331
44 L A -1.3141
45 D A -2.0614
46 T A -1.7177
47 A A -1.9641
48 L A -2.3744
49 R A -3.6034
50 R A -3.5228
51 A A -2.8979
52 R A -3.6878
53 S A -2.0660
54 A A -1.7626
55 P A -1.2115
56 A A -1.8302
57 E A -2.3409
58 P A -1.6929
59 I A 0.0000
60 A A -1.1858
61 A A 0.0000
62 R A -2.3703
63 V A 0.0000
64 T A -1.5303
65 G A -1.4673
66 Q A -1.6937
67 T A -1.5270
68 R A -2.4406
69 N A -2.5440
70 I A 0.0000
71 T A -1.4713
72 V A 0.0000
73 D A -2.0041
74 P A -2.2377
75 K A -2.9894
76 L A -1.7238
77 F A 0.0000
78 K A -4.0427
79 K A -4.1050
80 R A -4.2586
81 R A -4.0089
82 L A -2.7588
83 R A -2.9729
84 S A -1.4490
85 P A -0.7295
86 R A -0.6610
87 V A -0.3982
88 L A 0.0000
89 F A 0.0000
90 S A 0.0000
91 T A -0.7779
92 Q A -1.3728
93 P A -0.9140
94 P A 0.0000
95 P A -0.8660
96 T A -0.4191
97 S A -0.5944
98 S A -0.9269
99 D A -1.7911
100 T A -0.3903
101 L A 0.2689
102 D A -1.0757
103 L A 0.2674
104 D A -0.8107
105 F A 0.6432
106 Q A -1.0171
107 A A -0.8398
108 H A -1.1754
109 G A -0.6190
110 T A 0.5857
111 I A 2.0041
112 S A 1.0784
113 F A 1.1986
114 N A -1.1640
115 R A -2.4992
116 T A -2.0912
117 H A -2.9205
118 R A -3.4000
119 S A -2.7152
120 K A -3.3989
121 R A -3.1560
122 S A -1.8306
123 S A -1.3858
124 T A -0.7677
125 H A -0.3999
126 P A 0.5905
127 V A 2.1049
128 F A 2.3528
129 H A 0.5585
130 M A 1.1074
131 G A -0.2044
132 E A -0.9457
133 F A 0.8754
134 S A 0.2039
135 V A 0.3240
136 C A 0.0000
137 D A -1.0579
138 S A -0.5961
139 V A 0.6296
140 S A 1.0664
141 V A 2.2074
142 W A 1.1054
143 V A 0.3759
144 G A -0.9355
145 D A -2.0854
146 K A -1.2012
147 T A -0.9056
148 T A -0.9228
149 A A 0.0000
150 T A -1.6506
151 D A 0.0000
152 I A -0.0701
153 K A -1.6472
154 G A -1.6945
155 K A -2.3010
156 E A -2.6063
157 V A 0.0000
158 T A -1.0117
159 V A 0.0000
160 L A 0.0000
161 G A -1.2591
162 E A -1.1889
163 V A 0.0000
164 N A -1.1828
165 I A 0.0000
166 N A -1.7768
167 N A -1.6750
168 S A -0.8387
169 V A -0.3101
170 F A 0.0000
171 K A -1.2553
172 Q A 0.0000
173 Y A 0.0000
174 F A 0.0000
175 Y A 0.9590 mutated: FY175A
176 E A 0.0000
177 T A 0.0886
178 K A -0.7436
179 C A -1.1655
180 R A -2.1731
181 A A -1.5959
182 P A -1.3344
183 N A -2.3598
184 P A -1.5967
185 V A -1.0440
186 E A -2.0057
187 S A -1.9787
188 G A 0.0000
189 C A 0.0000
190 R A -1.2256
191 G A -0.6626
192 I A -1.1056
193 D A -2.5134
194 S A -2.7110
195 K A -2.9697
196 H A -2.6371
197 W A -2.2637
198 N A -2.3205
199 S A 0.0000
200 K A -0.9611 mutated: YK200A
201 C A 0.0000
202 T A -0.3298
203 T A -0.4911
204 T A -0.4971
205 H A -1.5091
206 T A -1.1749
207 K A -1.5969 mutated: FK207A
208 V A 0.0000
209 K A -1.9160
210 A A 0.0000
211 L A 0.0000
212 T A 0.0000
213 T A 0.0000
214 D A -2.5989
215 D A -3.1648
216 K A -3.5178
217 Q A -2.8156
218 A A -1.5225
219 A A -0.7903
220 W A -0.3569
221 R A -0.8543
222 K A -1.3290 mutated: FK222A
223 I A 0.0000
224 R A -1.8261
225 I A 0.0000
226 D A -1.0427
227 T A -0.7101
228 A A -0.0508
229 C A 0.0895
230 V A 1.1136
231 C A 0.9288
232 V A 1.2108
233 L A 0.3917
234 S A -1.2423
235 R A -2.8072
236 K A -2.8615
237 A A -1.7143
238 A A -1.9701
239 R A -2.9952
240 R A -2.9455
241 G A -1.9074
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.865 7.7922 View CSV PDB
4.5 -0.9337 7.7922 View CSV PDB
5.0 -1.0103 7.7922 View CSV PDB
5.5 -1.0781 7.7922 View CSV PDB
6.0 -1.121 7.7922 View CSV PDB
6.5 -1.1312 7.7922 View CSV PDB
7.0 -1.1158 7.7922 View CSV PDB
7.5 -1.0883 7.7922 View CSV PDB
8.0 -1.0547 7.7921 View CSV PDB
8.5 -1.013 7.792 View CSV PDB
9.0 -0.9602 7.7916 View CSV PDB