Project name: 182f400ef2b5aa

Status: done

Started: 2026-02-26 08:35:30
Chain sequence(s) B: QVQLVESGGGLVQPGGSLRLSCAASGRTFRTRAMGWFRQAPGQGLEAVAVISSSGRLTLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAASILRAASLLRDVYDYWGQGTLVTVS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/182f400ef2b5aa/tmp/folded.pdb                 (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:31)
Show buried residues

Minimal score value
-2.7371
Maximal score value
1.7576
Average score
-0.6421
Total score value
-78.9729

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q B -2.0654
2 V B 0.0000
3 Q B -1.2341
4 L B 0.0000
5 V B 1.0805
6 E B 0.3825
7 S B -0.2809
8 G B -0.7793
9 G B 0.0155
10 G B 0.5070
11 L B 1.3921
12 V B 0.0327
13 Q B -1.2626
14 P B -1.6427
15 G B -1.4281
16 G B -0.9320
17 S B -1.0772
18 L B -1.0035
19 R B -2.0464
20 L B 0.0000
21 S B -0.2385
22 C B 0.0000
23 A B 0.0455
24 A B -0.8782
25 S B -1.4850
26 G B -2.1809
27 R B -2.5785
28 T B -1.5781
29 F B 0.0000
30 R B -2.7371
31 T B -1.1971
32 R B -0.4635
33 A B 0.0000
34 M B 0.0000
35 G B 0.0000
36 W B 0.0000
37 F B 0.0000
38 R B -0.7795
39 Q B -1.2580
40 A B -1.3021
41 P B -1.2336
42 G B -1.3664
43 Q B -2.0878
44 G B -1.6486
45 L B -1.4010
46 E B -2.1327
47 A B 0.0000
48 V B 0.0000
49 A B 0.0000
50 V B 0.0000
51 I B 0.0000
52 S B 0.0000
53 S B 0.0000
54 S B -1.3974
55 G B -1.2958
56 R B -1.5907
57 L B -0.2345
58 T B 0.2405
59 L B 0.4287
60 Y B -0.6555
61 A B 0.0000
62 D B -2.4359
63 S B -2.0094
64 V B 0.0000
65 K B -2.5265
66 G B -1.7381
67 R B -1.2246
68 F B 0.0000
69 T B -0.6774
70 I B 0.0000
71 S B -0.5203
72 R B -1.0528
73 D B -1.7518
74 N B -2.0267
75 S B -1.7661
76 K B -2.4803
77 N B -2.1273
78 T B -0.9873
79 L B 0.0000
80 Y B -0.1392
81 L B 0.0000
82 Q B -1.0467
83 M B 0.0000
84 N B -1.3898
85 S B -1.2708
86 L B 0.0000
87 R B -2.5653
88 A B -1.8467
89 E B -2.3886
90 D B 0.0000
91 T B -0.4643
92 A B 0.0000
93 V B 0.7065
94 Y B 0.0000
95 Y B 0.2805
96 C B 0.0000
97 A B 0.0000
98 A B 0.0000
99 S B 0.0000
100 I B 1.7576
101 L B 0.9613
102 R B -1.0612
103 A B -0.3929
104 A B 0.0000
105 S B 0.4468
106 L B 0.5921
107 L B 0.2150
108 R B -2.0725
109 D B -2.2083
110 V B -0.4413
111 Y B 0.0000
112 D B -1.6400
113 Y B -0.5906
114 W B -0.1975
115 G B -0.2178
116 Q B -0.9281
117 G B -0.0397
118 T B 0.5118
119 L B 1.6015
120 V B 0.0000
121 T B 0.3301
122 V B 0.0000
123 S B -0.8026
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7043 2.686 View CSV PDB
4.5 -0.7441 2.6299 View CSV PDB
5.0 -0.7917 2.5531 View CSV PDB
5.5 -0.84 2.4657 View CSV PDB
6.0 -0.8817 2.3743 View CSV PDB
6.5 -0.9121 2.2816 View CSV PDB
7.0 -0.9308 2.1885 View CSV PDB
7.5 -0.9412 2.0958 View CSV PDB
8.0 -0.9458 2.0686 View CSV PDB
8.5 -0.9445 2.0686 View CSV PDB
9.0 -0.9364 2.0685 View CSV PDB