Project name: phlamhtrimer [mutate: LR73C, FH74D] [mutate: NI21C] [mutate: KL23C]

Status: done

Started: 2026-02-24 21:26:30
Chain sequence(s) C: DARRKAEMLQNEAKTLLAQAISKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCR
B: ENVERWQGQYEGLRGQDLGQAVLDAGHSVSTLEKTLPQLLAKLSILENRGVHNASLALSASIGRVRELCAQARGAASKVKV
D: DTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDYNRDIEEIMKCIRNLEDIRKTLPSGCHNTPSIEKP
input PDB
Selected Chain(s) B,C,D
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues KL23C
Energy difference between WT (input) and mutated protein (by FoldX) -0.733697 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:02:59)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:13)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/18b6f268d338254/tmp/folded.pdb                (00:03:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:57)
Show buried residues

Minimal score value
-4.3808
Maximal score value
1.2429
Average score
-1.5375
Total score value
-362.8469

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E B -2.8742
2 N B -2.3304
3 V B -0.8251
4 E B -2.9704
5 R B -3.2794
6 W B -1.2847
7 Q B -1.9296
8 G B -2.4602
9 Q B -2.0432
10 Y B -1.5875
11 E B -2.8553
12 G B -1.9248
13 L B -0.9737
14 R B -2.6302
15 G B -2.7076
16 Q B -2.2862
17 D B -2.2905
18 L B -2.3561
19 G B -1.3623
20 Q B -1.7443
21 A B 0.0000
22 V B 0.0000
23 L B -0.1039
24 D B -1.1828
25 A B 0.0000
26 G B -1.0341
27 H B -1.3324
28 S B -1.4439
29 V B 0.0000
30 S B -1.3336
31 T B -1.4028
32 L B 0.0000
33 E B -2.3473
34 K B -2.3773
35 T B -1.0821
36 L B 0.0000
37 P B -1.3216
38 Q B -1.1698
39 L B 0.0000
40 L B 0.0069
41 A B -0.0342
42 K B -0.3597
43 L B 0.0000
44 S B -0.2696
45 I B 0.7213
46 L B 0.0000
47 E B -2.0984
48 N B -1.4647
49 R B -0.8776
50 G B -0.4653
51 V B 0.9317
52 H B -0.2161
53 N B -0.6893
54 A B 0.0000
55 S B 0.2516
56 L B 1.2429
57 A B 0.2575
58 L B 0.0000
59 S B 0.1331
60 A B -0.0438
61 S B -0.7109
62 I B 0.0000
63 G B -1.8843
64 R B -2.3807
65 V B 0.0000
66 R B -2.8086
67 E B -3.2108
68 L B 0.0000
69 C B 0.0000
70 A B -1.9400
71 Q B -2.1764
72 A B 0.0000
73 R B -2.3307
74 G B -1.6402
75 A B -1.7392
76 A B -1.4526
77 S B -1.6346
78 K B -2.2337
79 V B 0.0000
80 K B -1.2777
81 V B 0.6643
1 D C -2.8229
2 A C -2.2957
3 R C -3.2955
4 R C -3.4451
5 K C -2.7394
6 A C 0.0000
7 E C -2.4890
8 M C -1.5909
9 L C 0.0000
10 Q C -2.1877
11 N C -2.4752
12 E C -1.9762
13 A C 0.0000
14 K C -2.3459
15 T C -1.3373
16 L C -0.7124
17 L C -0.6490
18 A C -0.0910
19 Q C -0.3950
20 A C 0.0000
21 I C 1.0465
22 S C 0.2109
23 L C -0.0657 mutated: KL23C
24 L C -0.1188
25 Q C -0.7644
26 L C -0.6644
27 L C 0.0000
28 K C -2.1765
29 D C -2.3765
30 L C 0.0000
31 E C -2.8841
32 R C -4.1596
33 K C -4.0174
34 Y C 0.0000
35 E C -4.3715
36 D C -4.3279
37 N C -3.2975
38 Q C -3.0516
39 R C -3.6070
40 Y C -2.1484
41 L C 0.0000
42 E C -2.9280
43 D C -2.5917
44 K C -2.1180
45 A C -1.7014
46 Q C -2.2986
47 E C -2.3805
48 L C 0.0000
49 A C -1.8465
50 R C -2.7556
51 L C -1.9159
52 E C -2.2675
53 G C -2.2434
54 E C -2.6825
55 V C 0.0000
56 R C -2.8535
57 S C -2.2765
58 L C 0.0000
59 L C -2.5635
60 K C -3.1397
61 D C -2.8451
62 I C 0.0000
63 S C -2.1474
64 Q C -2.1099
65 K C -1.5809
66 V C 0.0000
67 A C -0.5503
68 V C -0.0528
69 Y C -0.6160
70 S C -0.8431
71 T C -0.5587
72 C C -0.8927
73 R C -2.0648
1 D D -1.3025
2 T D -0.2958
3 V D 0.6573
4 D D -0.6893
5 L D -0.7401
6 N D -1.9314
7 K D -1.8542
8 L D 0.0000
9 N D -3.0713
10 E D -3.3376
11 I D 0.0000
12 E D -2.4506
13 G D -2.3091
14 T D -2.1609
15 L D 0.0000
16 N D -2.4323
17 K D -3.3478
18 A D 0.0000
19 K D -2.5859
20 D D -3.2247
21 E D -2.5296
22 M D -1.9461
23 K D -2.3845
24 V D -0.0602
25 S D -1.0153
26 D D -1.8864
27 L D 0.0000
28 D D -3.5277
29 R D -3.8621
30 K D -3.4394
31 V D 0.0000
32 S D -3.2034
33 D D -4.2772
34 L D 0.0000
35 E D -3.6431
36 N D -4.1575
37 E D -4.2672
38 A D 0.0000
39 K D -4.3808
40 K D -3.9293
41 Q D -3.1516
42 E D -3.0774
43 A D -2.0083
44 A D -1.6978
45 I D 0.0000
46 M D -1.1295
47 D D -2.4701
48 Y D -1.8661
49 N D -2.0162
50 R D -3.3561
51 D D -3.0251
52 I D 0.0000
53 E D -3.2388
54 E D -3.3896
55 I D 0.0000
56 M D -2.1304
57 K D -2.9205
58 C D -2.4616
59 I D 0.0000
60 R D -3.4774
61 N D -3.0551
62 L D 0.0000
63 E D -3.4561
64 D D -3.5223
65 I D -2.3614
66 R D -2.6952
67 K D -2.7161
68 T D -1.2592
69 L D -0.8141
70 P D -0.3051
71 S D -0.5161
72 G D -0.4602
73 C D -0.8803
74 H D -1.6860
75 N D -2.1324
76 T D -0.9769
77 P D -0.7362
78 S D -0.3630
79 I D 0.3722
80 E D -1.8395
81 K D -2.1345
82 P D -1.2832
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.581 1.6617 View CSV PDB
4.5 -1.6988 1.6461 View CSV PDB
5.0 -1.8457 1.6513 View CSV PDB
5.5 -1.9943 1.662 View CSV PDB
6.0 -2.1154 1.6773 View CSV PDB
6.5 -2.1886 1.691 View CSV PDB
7.0 -2.2115 1.699 View CSV PDB
7.5 -2.198 1.7024 View CSV PDB
8.0 -2.1638 1.7035 View CSV PDB
8.5 -2.1148 1.7039 View CSV PDB
9.0 -2.0489 1.704 View CSV PDB