Project name: ok 8

Status: done

Started: 2026-03-17 06:56:46
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASQSVSYMNWYKQKPGLAPRLLIYDTSNLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:10)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:10)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:10)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:39)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/18dd3d77a49535d/tmp/folded.pdb                (00:02:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:42)
Show buried residues

Minimal score value
-3.4181
Maximal score value
1.3406
Average score
-0.7106
Total score value
-169.8438

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8540
2 I A 0.0000
3 V A 0.8340
4 L A 0.0000
5 T A -0.3447
6 K A -0.6043
7 S A -0.5603
8 P A -0.4167
9 A A -0.5915
10 T A -0.4921
11 L A -0.3544
12 S A -0.6818
13 L A -0.9760
14 S A -1.6063
15 P A -1.8419
16 G A -2.4518
17 E A -2.9292
18 R A -3.2258
19 A A 0.0000
20 T A -0.5303
21 L A 0.0000
22 S A -0.7119
23 C A 0.0000
24 S A -0.9616
25 A A 0.0000
26 S A -0.7277
27 Q A -1.5733
28 S A -1.2981
29 V A 0.0000
30 S A -0.5157
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.6034
37 Q A 0.0000
38 K A -0.5434
39 P A -0.1135
40 G A -0.0178
41 L A 0.6500
42 A A -0.1472
43 P A 0.0000
44 R A -1.4471
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.3501
49 D A -0.9188
50 T A -0.6929
51 S A -0.6373
52 N A -0.5097
53 L A -0.1308
54 A A 0.0000
55 T A -0.2442
56 G A -0.7914
57 I A -0.6757
58 P A -0.9651
59 D A -1.9163
60 R A -1.9304
61 F A 0.0000
62 S A -0.7155
63 G A -0.4690
64 S A -0.9316
65 G A -1.1715
66 S A -1.0965
67 G A -1.2209
68 T A -1.5785
69 D A -2.2656
70 F A 0.0000
71 T A -0.7475
72 L A 0.0000
73 T A -0.7950
74 I A 0.0000
75 S A -2.5333
76 R A -3.4181
77 L A 0.0000
78 E A -2.2426
79 P A -1.5634
80 E A -1.6869
81 D A 0.0000
82 F A -0.5961
83 A A 0.0000
84 V A -0.5447
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.1283
91 S A -0.3202
92 S A -1.2532
93 N A -1.8394
94 P A -1.5856
95 F A 0.0000
96 T A 0.0000
97 F A 0.0000
98 G A 0.0000
99 Q A -1.3977
100 G A 0.0000
101 T A 0.0000
102 K A -1.1938
103 L A 0.0000
104 E A -0.9897
105 I A -0.8858
106 K A -1.9155
107 G A -1.5015
108 G A -1.3322
109 G A -1.1820
110 G A -1.2992
111 S A -1.0702
112 G A -1.4278
113 G A -1.4588
114 G A -1.3867
115 G A -1.4645
116 S A -1.0573
117 G A -1.2747
118 G A -1.2327
119 G A -1.3360
120 G A -1.4324
121 S A -1.3829
122 Q A -1.7823
123 V A 0.0000
124 Q A -1.4702
125 L A 0.0000
126 V A 0.4967
127 Q A 0.0000
128 S A -0.4574
129 G A -0.5623
130 A A -0.0367
131 E A -0.0468
132 V A 0.9221
133 Q A -0.8235
134 K A -2.0384
135 P A -1.9958
136 G A -1.4105
137 A A -1.1380
138 S A -1.1828
139 V A 0.0000
140 K A -1.4968
141 V A 0.0000
142 S A -0.5011
143 C A 0.0000
144 K A -0.9377
145 A A 0.0000
146 S A -0.7745
147 G A -0.9108
148 Y A -0.6915
149 T A -0.7865
150 F A 0.0000
151 N A -2.1565
152 R A -2.4087
153 Y A -1.2575
154 T A -0.6224
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A -0.1842
160 Q A -0.3615
161 A A -0.7347
162 P A -0.7146
163 G A -1.0569
164 Q A -1.0754
165 L A 0.0000
166 L A -0.3200
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.5177
171 I A 0.0000
172 N A -0.5994
173 P A 0.0000
174 S A -1.6813
175 R A -1.5256
176 G A -0.3010
177 Y A 1.1070
178 Y A 1.3406
179 N A -0.2237
180 Y A -1.1650
181 A A -1.8734
182 Q A -2.8083
183 K A -2.9152
184 F A 0.0000
185 K A -3.1853
186 D A -3.0587
187 R A -2.0165
188 V A 0.0000
189 T A -0.8453
190 M A 0.0000
191 T A -0.2851
192 R A -1.2702
193 D A -1.2534
194 T A -0.9137
195 S A -0.5773
196 T A -0.6999
197 S A -0.9369
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7263
201 M A 0.0000
202 E A -1.2666
203 L A 0.0000
204 S A -1.1703
205 S A -1.1948
206 L A 0.0000
207 R A -2.4725
208 S A -2.1105
209 E A -2.3415
210 D A 0.0000
211 T A -0.7935
212 A A -0.3263
213 V A 0.0516
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1667
221 D A -2.4907
222 D A -2.5136
223 H A -1.4614
224 Y A -0.4934
225 C A 0.0000
226 L A 0.0000
227 D A -0.4519
228 Y A -0.4486
229 W A -0.4236
230 G A 0.0000
231 Q A -0.6756
232 G A -0.1919
233 T A 0.0000
234 T A -0.0137
235 V A 0.0000
236 T A -0.2700
237 V A 0.0000
238 S A -0.7901
239 S A -1.0895
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6929 2.1929 View CSV PDB
4.5 -0.7332 2.1972 View CSV PDB
5.0 -0.7809 2.208 View CSV PDB
5.5 -0.8276 2.2294 View CSV PDB
6.0 -0.8652 2.2608 View CSV PDB
6.5 -0.8884 2.2979 View CSV PDB
7.0 -0.8969 2.3372 View CSV PDB
7.5 -0.8952 2.3773 View CSV PDB
8.0 -0.8871 2.4173 View CSV PDB
8.5 -0.8732 2.4567 View CSV PDB
9.0 -0.8521 2.4939 View CSV PDB