Project name: 18f657d5eb4da89

Status: done

Started: 2026-07-27 15:39:26
Chain sequence(s) A: QVQLQESGPGLVKPSETLSLTCTVSGFSLTGYGVNWIRQPPGKGLEWIGMIWVDGSTDYNSALKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGGYGAMDYWGQGTLVTVSS
B: DIQMTQSPSTLSASVGDRVTITCHASQNINVWLTWYQQKPGKAPKLLIYKASNLHTGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQGQSYPWTFGGGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:41)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/18f657d5eb4da89/tmp/folded.pdb                (00:01:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:00)
Show buried residues

Minimal score value
-2.9298
Maximal score value
1.6509
Average score
-0.5874
Total score value
-130.9845

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5607
2 V A -1.0749
3 Q A -1.7426
4 L A 0.0000
5 Q A -1.4714
6 E A 0.0000
7 S A -0.4490
8 G A -0.2917
9 P A 0.0617
10 G A 0.7100
11 L A 1.0792
12 V A 0.0000
13 K A -1.9888
14 P A -1.4266
15 S A -1.4572
16 E A -2.0436
17 T A -1.4451
18 L A 0.0000
19 S A -0.8968
20 L A 0.0000
21 T A -0.5817
22 C A 0.0000
23 T A -1.2587
24 V A 0.0000
25 S A -1.3430
26 G A -1.1089
27 F A -0.4761
28 S A -0.1947
29 L A -0.0674
30 T A -0.1556
31 G A 0.0665
32 Y A 0.6433
33 G A 0.0000
34 V A 0.0000
35 N A 0.0000
36 W A 0.0000
37 I A 0.0000
38 R A 0.0000
39 Q A -0.6169
40 P A -0.7389
41 P A -0.8344
42 G A -1.5065
43 K A -2.2632
44 G A -1.3919
45 L A 0.0000
46 E A -0.7489
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 M A 0.0000
51 I A 0.0000
52 W A -0.2107
53 V A -0.4372
54 D A -1.5974
55 G A -1.0744
56 S A -0.7580
57 T A -0.5291
58 D A -0.6100
59 Y A -0.5549
60 N A -0.8183
61 S A -1.0379
62 A A -0.5785
63 L A 0.0000
64 K A -2.0115
65 S A -1.2614
66 R A -1.3412
67 V A 0.0000
68 T A -0.8758
69 I A 0.0000
70 S A -0.6034
71 V A -0.9066
72 D A -1.8039
73 T A -1.5416
74 S A -1.5702
75 K A -2.4894
76 N A -1.7436
77 Q A -1.7009
78 F A 0.0000
79 S A -0.6176
80 L A 0.0000
81 K A -1.2891
82 L A 0.0000
83 S A -1.0963
84 S A -1.1270
85 V A 0.0000
86 T A -0.6654
87 A A -0.2609
88 A A 0.0434
89 D A 0.0000
90 T A 0.4193
91 A A 0.0000
92 V A 0.6759
93 Y A 0.0000
94 Y A 0.0000
95 C A 0.0000
96 A A 0.0000
97 R A 0.0000
98 G A 0.0000
99 G A 0.6704
100 Y A 1.2546
101 G A 0.0000
102 A A 0.3357
103 M A 0.0000
104 D A -0.3027
105 Y A -0.2143
106 W A -0.7861
107 G A 0.0000
108 Q A -1.8584
109 G A 0.0000
110 T A 0.2901
111 L A 1.6509
112 V A 0.0000
113 T A 0.5443
114 V A 0.0000
115 S A -0.4809
116 S A -0.7123
1 D B -2.1199
2 I B -1.7722
3 Q B -1.9664
4 M B 0.0000
5 T B -0.9264
6 Q B -0.6841
7 S B -0.5944
8 P B -0.5091
9 S B -0.7170
10 T B -0.7946
11 L B -0.4492
12 S B -0.9095
13 A B 0.0000
14 S B -0.8648
15 V B -0.1745
16 G B -0.9252
17 D B -1.7352
18 R B -2.3280
19 V B 0.0000
20 T B -0.6095
21 I B 0.0000
22 T B -0.6126
23 C B 0.0000
24 H B -1.7171
25 A B 0.0000
26 S B -1.8929
27 Q B -2.6584
28 N B -2.3503
29 I B 0.0000
30 N B -1.3806
31 V B -0.3805
32 W B 0.0052
33 L B 0.0000
34 T B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -2.6223
40 P B -1.6738
41 G B -1.8917
42 K B -2.9298
43 A B -1.8639
44 P B 0.0000
45 K B -1.9103
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.1820
50 K B -0.4817
51 A B 0.0000
52 S B -0.5397
53 N B -0.5251
54 L B 0.0875
55 H B -0.2421
56 T B -0.2961
57 G B -0.4132
58 V B -0.3224
59 P B -0.3223
60 S B -0.4200
61 R B -0.8023
62 F B 0.0000
63 S B -0.3974
64 G B -0.4464
65 S B -0.8246
66 G B -1.0374
67 S B -1.1250
68 G B -1.5442
69 T B -1.8674
70 E B -2.1487
71 F B 0.0000
72 T B -0.6777
73 L B 0.0000
74 T B -0.6283
75 I B 0.0000
76 S B -1.3834
77 S B -1.2457
78 L B 0.0000
79 Q B -1.0303
80 P B -1.2260
81 D B -1.8829
82 D B 0.0000
83 F B -1.0514
84 A B 0.0000
85 T B -1.0567
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 G B 0.1850
92 Q B -0.4455
93 S B -0.2274
94 Y B 0.0938
95 P B -0.2288
96 W B 0.0000
97 T B -0.5914
98 F B -0.2824
99 G B 0.0000
100 G B -1.1157
101 G B -0.9437
102 T B 0.0000
103 K B -1.6381
104 L B 0.0000
105 E B -1.4641
106 I B -0.9955
107 K B -1.5460
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.623 2.6338 View CSV PDB
4.5 -0.6533 2.6338 View CSV PDB
5.0 -0.686 2.6338 View CSV PDB
5.5 -0.7131 2.6338 View CSV PDB
6.0 -0.7258 2.6338 View CSV PDB
6.5 -0.7188 2.6338 View CSV PDB
7.0 -0.6945 2.6338 View CSV PDB
7.5 -0.6598 2.6338 View CSV PDB
8.0 -0.6193 2.6338 View CSV PDB
8.5 -0.5736 2.6338 View CSV PDB
9.0 -0.5231 2.6338 View CSV PDB