Project name: 562fd5e4b1c0dfe [mutate: GA237A, KA246A, RA255A, HA268A, RA301A, EA356A]

Status: done

Started: 2026-03-28 12:25:14
Chain sequence(s) A: GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
B: GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues GA237A,RA255A,KA246A,HA268A,RA301A,EA356A
Energy difference between WT (input) and mutated protein (by FoldX) 4.59797 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:02:41)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:18)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1955dc7444650aa/tmp/folded.pdb                (00:04:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:09)
Show buried residues

Minimal score value
-3.7673
Maximal score value
1.7099
Average score
-0.8438
Total score value
-349.3207

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
237 A A -0.4046 mutated: GA237A
238 P A 0.0000
239 S A 0.0768
240 V A 0.0000
241 F A 1.2988
242 L A 0.0000
243 F A 1.6184
244 P A 0.4107
245 P A 0.0000
246 A A -0.5719 mutated: KA246A
247 P A -0.8963
248 K A -0.9294
249 D A -0.6920
250 T A 0.0000
251 L A 0.0000
252 M A 0.6206
253 I A 1.7099
254 S A 0.6846
255 A A 0.1906 mutated: RA255A
256 T A 0.0592
257 P A 0.0000
258 E A -0.5609
259 V A 0.0000
260 T A 0.4312
261 C A 0.0000
262 V A 0.9079
263 V A 0.0000
264 V A -0.0902
265 D A -1.3985
266 V A 0.0000
267 S A -1.4709
268 A A -1.5916 mutated: HA268A
269 E A -2.4682
270 D A -2.2913
271 P A -2.2656
272 E A -2.7453
273 V A -1.7199
274 K A -2.1565
275 F A -1.1066
276 N A -1.1301
277 W A 0.0000
278 Y A -0.7004
279 V A -1.0111
280 D A -2.0998
281 G A -0.8935
282 V A 0.6970
283 E A -0.6589
284 V A -0.4922
285 H A -1.8495
286 N A -2.1653
287 A A -1.8639
288 K A -2.3884
289 T A -1.6574
290 K A -2.2351
291 P A -2.2628
292 R A -3.5412
293 E A -3.7673
294 E A -3.2554
295 Q A -2.2235
296 Y A -0.4897
297 N A -1.4059
298 S A -1.0538
299 T A -1.5937
300 Y A -1.9615
301 A A -1.8083 mutated: RA301A
302 V A 0.0000
303 V A -0.6903
304 S A 0.0000
305 V A 0.0000
306 L A 0.0000
307 T A -0.6185
308 V A 0.0000
309 L A 0.7178
310 H A -0.0523
311 Q A -1.2047
312 D A -1.3117
313 W A 0.0000
314 L A -1.0291
315 N A -2.1248
316 G A -2.1402
317 K A -2.4463
318 E A -2.5119
319 Y A 0.0000
320 K A -1.7874
321 C A 0.0000
322 K A -1.5857
323 V A 0.0000
324 S A -1.4344
325 N A 0.0000
326 K A -2.4781
327 A A -1.2690
328 L A -0.4655
329 P A -0.4474
330 A A -0.4383
331 P A -0.9116
332 I A -0.8039
333 E A -2.1310
334 K A -1.2472
335 T A -1.0549
336 I A -0.1249
337 S A -0.9833
338 K A -1.3636
339 A A -1.2027
340 K A -2.3265
341 G A -2.0382
342 Q A -2.0407
343 P A -1.9241
344 R A -2.3946
345 E A -2.5872
346 P A 0.0000
347 Q A -0.8739
348 V A 0.0000
349 Y A 0.0000
350 T A -0.4963
351 L A 0.0000
352 P A -0.1138
353 P A 0.0000
354 S A -0.9219
355 R A -1.8084
356 A A -0.9379 mutated: EA356A
357 E A 0.0000
358 M A -1.2096
359 T A -0.9525
360 K A -1.5756
361 N A -2.3068
362 Q A -2.2084
363 V A 0.0000
364 S A 0.0000
365 L A 0.0000
366 T A 0.0000
367 C A 0.0000
368 L A 0.0000
369 V A 0.0000
370 K A -0.3742
371 G A 0.0000
372 F A 0.0000
373 Y A -1.2374
374 P A 0.0000
375 S A -0.2945
376 D A -1.0596
377 I A -0.4486
378 A A -0.3401
379 V A -0.2885
380 E A -1.2464
381 W A 0.0000
382 E A -1.7311
383 S A 0.0000
384 N A -1.8041
385 G A -1.8608
386 Q A -2.2781
387 P A -1.9791
388 E A -1.9338
389 N A -2.2327
390 N A -1.8144
391 Y A -1.1199
392 K A -0.8434
393 T A -0.2754
394 T A 0.0000
395 P A -0.0617
396 P A 0.1874
397 V A 0.7616
398 L A 1.0990
399 D A -0.2569
400 S A -1.1277
401 D A -1.9093
402 G A -1.0514
403 S A 0.0000
404 F A 0.1985
405 F A 0.0000
406 L A 0.0000
407 Y A 0.0000
408 S A 0.0000
409 K A 0.0000
410 L A 0.0000
411 T A -0.9728
412 V A 0.0000
413 D A -2.4895
414 K A -2.5162
415 S A -2.1787
416 R A -2.0039
417 W A 0.0000
418 Q A -2.0662
419 Q A -1.8922
420 G A -0.6884
421 N A -0.3966
422 V A 0.8245
423 F A 0.0000
424 S A -0.6205
425 C A 0.0000
426 S A 0.0000
427 V A 0.0000
428 M A -0.4416
429 H A 0.0000
430 E A -1.1339
431 A A -1.6398
432 L A -1.4551
433 H A -1.7601
434 N A -1.4478
435 H A -0.9215
436 Y A -0.3587
437 T A -0.5558
438 Q A -0.8417
439 K A -0.8090
440 S A -0.3016
441 L A 0.0000
442 S A 0.6640
443 L A 1.1075
237 G B -0.8653
238 P B 0.0000
239 S B -0.0610
240 V B 0.0000
241 F B 1.3221
242 L B 0.0000
243 F B 1.2974
244 P B -0.0276
245 P B 0.0000
246 K B -2.0384
247 P B -1.3647
248 K B -1.0423
249 D B -1.1147
250 T B 0.0000
251 L B 0.0000
252 M B 0.5107
253 I B 1.5998
254 S B 0.2700
255 R B -0.6779
256 T B -0.5270
257 P B 0.0000
258 E B -0.9368
259 V B 0.0000
260 T B 0.3104
261 C B 0.0000
262 V B 0.0000
263 V B 0.0000
264 V B -0.2989
265 D B -1.4996
266 V B 0.0000
267 S B -1.8745
268 H B -2.0019
269 E B -2.7324
270 D B -2.4448
271 P B -2.5393
272 E B -2.8558
273 V B -1.7462
274 K B -2.1732
275 F B -1.1042
276 N B -1.0815
277 W B 0.0000
278 Y B -0.6495
279 V B -0.9591
280 D B -2.0619
281 G B -0.8662
282 V B 0.7169
283 E B -0.6352
284 V B -0.4659
285 H B -1.8434
286 N B -2.1618
287 A B -1.8655
288 K B -2.4254
289 T B -1.7299
290 K B -2.4325
291 P B -2.3981
292 R B -3.4408
293 E B -3.3169
294 E B -2.0750
295 Q B -1.4390
296 Y B 0.0252
297 N B -1.1025
298 S B -0.8804
299 T B -1.4545
300 Y B -1.8626
301 R B -2.1029
302 V B 0.0000
303 V B 0.0000
304 S B 0.0000
305 V B 0.0000
306 L B 0.0000
307 T B -0.6415
308 V B 0.0000
309 L B 0.5981
310 H B -0.1855
311 Q B -1.1920
312 D B -1.3209
313 W B 0.0000
314 L B -1.0284
315 N B -2.1176
316 G B -2.1093
317 K B -2.3380
318 E B -2.4406
319 Y B 0.0000
320 K B -1.6110
321 C B 0.0000
322 K B -1.4489
323 V B 0.0000
324 S B -1.4158
325 N B 0.0000
326 K B -2.5334
327 A B -1.3947
328 L B -0.5611
329 P B -0.5171
330 A B -0.4169
331 P B -0.8735
332 I B -0.7146
333 E B -1.9252
334 K B -1.0959
335 T B -0.9428
336 I B -0.1050
337 S B -0.9728
338 K B -1.3403
339 A B -1.2029
340 K B -2.3194
341 G B -2.0224
342 Q B -2.0408
343 P B -1.9530
344 R B -2.4367
345 E B -2.6116
346 P B 0.0000
347 Q B -0.8316
348 V B 0.0000
349 Y B 0.0000
350 T B -0.5218
351 L B 0.0000
352 P B -0.2239
353 P B -0.6784
354 S B 0.0000
355 R B -1.9729
356 E B -1.3461
357 E B 0.0000
358 M B -1.3069
359 T B -1.1869
360 K B -1.8949
361 N B -2.4226
362 Q B -2.3926
363 V B 0.0000
364 S B 0.0000
365 L B 0.0000
366 T B 0.0000
367 C B 0.0000
368 L B 0.0000
369 V B 0.0000
370 K B -0.4142
371 G B 0.0000
372 F B 0.0000
373 Y B -1.2713
374 P B 0.0000
375 S B -0.3127
376 D B -1.1814
377 I B -0.5155
378 A B -0.4091
379 V B -0.3756
380 E B -1.4447
381 W B 0.0000
382 E B -1.8252
383 S B -1.2461
384 N B -1.8479
385 G B -1.7460
386 Q B -2.2799
387 P B -2.0154
388 E B -1.9811
389 N B -2.2888
390 N B -1.8951
391 Y B -1.1738
392 K B -0.7593
393 T B -0.2298
394 T B 0.0000
395 P B -0.1092
396 P B 0.0968
397 V B 0.5367
398 L B 0.6896
399 D B -0.4251
400 S B -1.1934
401 D B -1.9500
402 G B -1.1208
403 S B 0.0000
404 F B 0.0585
405 F B 0.0000
406 L B 0.0000
407 Y B 0.0000
408 S B 0.0000
409 K B 0.0000
410 L B 0.0000
411 T B -0.9778
412 V B 0.0000
413 D B -2.8959
414 K B -2.9887
415 S B -2.7955
416 R B -3.1631
417 W B 0.0000
418 Q B -2.5790
419 Q B -2.3460
420 G B -0.9980
421 N B -0.9104
422 V B 0.3339
423 F B 0.0000
424 S B 0.0000
425 C B 0.0000
426 S B 0.0000
427 V B 0.0000
428 M B -0.3291
429 H B 0.0000
430 E B -1.1240
431 A B -1.6099
432 L B -1.4181
433 H B -1.7176
434 N B -1.5907
435 H B -1.0049
436 Y B -0.2916
437 T B -0.6522
438 Q B -1.1606
439 K B -1.0948
440 S B -0.5061
441 L B 0.0000
442 S B 0.3332
443 L B 1.1688
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6351 4.43 View CSV PDB
4.5 -0.7002 4.4091 View CSV PDB
5.0 -0.7795 4.3847 View CSV PDB
5.5 -0.8566 4.3623 View CSV PDB
6.0 -0.9142 4.3482 View CSV PDB
6.5 -0.94 4.3468 View CSV PDB
7.0 -0.9346 4.3566 View CSV PDB
7.5 -0.9101 4.3725 View CSV PDB
8.0 -0.8762 4.3908 View CSV PDB
8.5 -0.8359 4.4099 View CSV PDB
9.0 -0.7889 4.4291 View CSV PDB