Project name: 19fc3c2e8012f23

Status: done

Started: 2026-03-13 21:12:08
Chain sequence(s) A: QVQLVESGGGVVQPGRSLRLSCGASGFTFRNYGMQWVRQGPGKGLEWVTLISFDGNDKYYADSVKGRFTISRDNSKNTLFLQMNSLRTEDTAVYYCARGGDFDYWGQGTLVTVSS
B: DIQMTQSPSSLSASVGDRVTITCRASQDIRKDLGWYQQKPGKAPKRLIYAASSLHSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPMYTFGQGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/19fc3c2e8012f23/tmp/folded.pdb                (00:03:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:16)
Show buried residues

Minimal score value
-3.8117
Maximal score value
1.7556
Average score
-0.7131
Total score value
-159.0165

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4351
2 V A -0.7829
3 Q A -0.9275
4 L A 0.0000
5 V A 1.0963
6 E A 0.0000
7 S A -0.1842
8 G A -0.7017
9 G A 0.2012
10 G A 0.8043
11 V A 1.7556
12 V A -0.0854
13 Q A -1.3151
14 P A -1.8517
15 G A -2.1059
16 R A -2.6675
17 S A -1.9743
18 L A -1.2717
19 R A -1.8950
20 L A 0.0000
21 S A -0.3244
22 C A 0.0000
23 G A -0.2230
24 A A 0.0000
25 S A -0.7978
26 G A -0.9776
27 F A -0.7071
28 T A -0.9730
29 F A 0.0000
30 R A -2.7250
31 N A -1.7469
32 Y A -0.3731
33 G A -0.2286
34 M A 0.0000
35 Q A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6910
40 G A -1.1520
41 P A -0.8918
42 G A -1.4977
43 K A -2.4012
44 G A -1.6696
45 L A 0.0000
46 E A -1.1862
47 W A 0.0000
48 V A 0.0000
49 T A 0.0000
50 L A 0.2569
51 I A 0.0000
52 S A -0.8540
53 F A -0.4217
54 D A -2.2457
55 G A -1.8911
56 N A -2.1941
57 D A -1.8513
58 K A -1.1220
59 Y A -0.2545
60 Y A -0.7614
61 A A -1.2460
62 D A -2.3501
63 S A -1.6890
64 V A 0.0000
65 K A -2.4422
66 G A -1.6422
67 R A 0.0000
68 F A 0.0000
69 T A -0.7918
70 I A 0.0000
71 S A -0.8395
72 R A -1.1073
73 D A -1.9282
74 N A -2.3459
75 S A -1.8386
76 K A -2.5630
77 N A -2.0572
78 T A -1.1537
79 L A 0.0000
80 F A -0.4220
81 L A 0.0000
82 Q A -1.0977
83 M A 0.0000
84 N A -1.8181
85 S A -1.7014
86 L A 0.0000
87 R A -2.4247
88 T A -1.7457
89 E A -2.2754
90 D A 0.0000
91 T A -0.3837
92 A A 0.0000
93 V A 0.7525
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 G A -0.1153
100 G A -0.3167
101 D A -0.6125
102 F A 0.0000
103 D A -0.4450
104 Y A -0.0755
105 W A -0.2234
106 G A 0.0000
107 Q A -1.1375
108 G A 0.0000
109 T A 0.6579
110 L A 1.6212
111 V A 0.0000
112 T A 0.5150
113 V A 0.0000
114 S A -0.5905
115 S A -0.5237
1 D B -2.0676
2 I B 0.0000
3 Q B -2.2112
4 M B 0.0000
5 T B -1.2697
6 Q B 0.0000
7 S B -0.6597
8 P B -0.5608
9 S B -0.8517
10 S B -1.0468
11 L B -0.6265
12 S B -0.8688
13 A B 0.0000
14 S B -0.1103
15 V B 0.6640
16 G B -0.5241
17 D B -1.3523
18 R B -2.1318
19 V B 0.0000
20 T B -0.5621
21 I B 0.0000
22 T B -0.7871
23 C B 0.0000
24 R B -2.5563
25 A B 0.0000
26 S B -2.2540
27 Q B -3.0508
28 D B -3.6221
29 I B 0.0000
30 R B -3.8117
31 K B -3.4114
32 D B -2.1842
33 L B 0.0000
34 G B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -1.7595
40 P B -1.1858
41 G B -1.6322
42 K B -2.6342
43 A B -1.7276
44 P B 0.0000
45 K B -1.8519
46 R B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.0101
50 A B -0.9588
51 A B 0.0000
52 S B -0.4920
53 S B 0.0008
54 L B 0.3896
55 H B -0.1980
56 S B -0.3473
57 G B -0.4825
58 V B -0.3620
59 P B -0.3182
60 S B -0.3956
61 R B -0.7881
62 F B 0.0000
63 S B -0.2954
64 G B -0.2284
65 S B -0.9918
66 G B -1.7292
67 S B -2.5299
68 G B -3.0285
69 T B -2.9488
70 E B -3.2220
71 F B 0.0000
72 T B -0.8186
73 L B 0.0000
74 T B -0.5984
75 I B 0.0000
76 S B -1.2608
77 S B -1.0271
78 L B 0.0000
79 Q B -0.8861
80 P B -0.6650
81 E B -1.9085
82 D B 0.0000
83 F B -0.6488
84 A B 0.0000
85 T B -1.0738
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 L B 0.0000
90 Q B 0.0000
91 H B -0.4964
92 N B -0.9736
93 S B 0.0850
94 Y B 1.0190
95 P B 0.8311
96 M B 0.2409
97 Y B 0.0000
98 T B -0.7667
99 F B 0.0000
100 G B 0.0000
101 Q B -1.7324
102 G B 0.0000
103 T B 0.0000
104 K B -1.7242
105 L B 0.0000
106 E B -1.1720
107 I B 0.6122
108 K B -0.8857
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8165 2.2019 View CSV PDB
4.5 -0.8596 2.2019 View CSV PDB
5.0 -0.9084 2.2019 View CSV PDB
5.5 -0.9544 2.2019 View CSV PDB
6.0 -0.9883 2.2019 View CSV PDB
6.5 -1.0033 2.2019 View CSV PDB
7.0 -1.0 2.2019 View CSV PDB
7.5 -0.9844 2.2019 View CSV PDB
8.0 -0.9609 2.2019 View CSV PDB
8.5 -0.9301 2.2019 View CSV PDB
9.0 -0.8914 2.2019 View CSV PDB