| Chain sequence(s) |
A: GGGGSMMLKKILKIEELDERELIDIEVSGNHLFYANDILTHNSAS
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| pH calculations | No |
| alphaCutter usage | No |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimization (00:00:01)
[INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:00:33)
[INFO] AutoMutEv:Residue number 7 from chain A and a score of 1.984 omitted from automated
mutation (excluded by the user). (00:00:33)
[INFO] AutoMutEv:Residue number 23 from chain A and a score of 1.933 (isoleucine) selected
for automated mutation (00:00:33)
[INFO] AutoMutEv:Residue number 6 from chain A and a score of 1.724 omitted from automated
mutation (excluded by the user). (00:00:33)
[INFO] AutoMutEv:Residue number 39 from chain A and a score of 1.691 (leucine) selected for
automated mutation (00:00:33)
[INFO] AutoMutEv:Residue number 38 from chain A and a score of 1.601 (isoleucine) selected
for automated mutation (00:00:33)
[INFO] AutoMutEv:Residue number 11 from chain A and a score of 1.582 (isoleucine) selected
for automated mutation (00:00:33)
[INFO] AutoMutEv:Residue number 34 from chain A and a score of 1.530 omitted from automated
mutation (excluded by the user). (00:00:33)
[INFO] AutoMutEv:Residue number 8 from chain A and a score of 1.514 omitted from automated
mutation (excluded by the user). (00:00:33)
[INFO] AutoMutEv:Residue number 12 from chain A and a score of 1.444 (leucine) selected for
automated mutation (00:00:33)
[INFO] AutoMutEv:Residue number 33 from chain A and a score of 1.093 omitted from automated
mutation (excluded by the user). (00:00:33)
[INFO] AutoMutEv:Residue number 14 from chain A and a score of 0.768 (isoleucine) selected
for automated mutation (00:00:33)
[INFO] AutoMutEv:Mutating residue number 23 from chain A (isoleucine) into threonine (00:00:33)
[INFO] AutoMutEv:Mutating residue number 23 from chain A (isoleucine) into leucine (00:00:33)
[INFO] AutoMutEv:Mutating residue number 38 from chain A (isoleucine) into threonine (00:00:33)
[INFO] AutoMutEv:Mutating residue number 23 from chain A (isoleucine) into methionine (00:00:40)
[INFO] AutoMutEv:Mutating residue number 39 from chain A (leucine) into methionine (00:00:41)
[INFO] AutoMutEv:Mutating residue number 38 from chain A (isoleucine) into leucine (00:00:47)
[INFO] AutoMutEv:Mutating residue number 11 from chain A (isoleucine) into methionine (00:00:49)
[INFO] AutoMutEv:Mutating residue number 38 from chain A (isoleucine) into methionine (00:00:50)
[INFO] AutoMutEv:Mutating residue number 11 from chain A (isoleucine) into leucine (00:01:00)
[INFO] AutoMutEv:Mutating residue number 11 from chain A (isoleucine) into threonine (00:01:04)
[INFO] AutoMutEv:Mutating residue number 12 from chain A (leucine) into methionine (00:01:10)
[INFO] AutoMutEv:Mutating residue number 14 from chain A (isoleucine) into methionine (00:01:12)
[INFO] AutoMutEv:Mutating residue number 14 from chain A (isoleucine) into threonine (00:01:17)
[INFO] AutoMutEv:Mutating residue number 14 from chain A (isoleucine) into leucine (00:01:20)
[INFO] AutoMutEv:Effect of mutation residue number 23 from chain A (isoleucine) into
threonine: Energy difference: -0.0545 kcal/mol, Difference in average score
from the base case: -0.0854 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 23 from chain A (isoleucine) into
methionine: Energy difference: -0.1302 kcal/mol, Difference in average
score from the base case: -0.0666 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 23 from chain A (isoleucine) into
leucine: Energy difference: -0.0314 kcal/mol, Difference in average score
from the base case: -0.0168 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 39 from chain A (leucine) into
methionine: Energy difference: 0.3587 kcal/mol, Difference in average score
from the base case: -0.0227 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 38 from chain A (isoleucine) into
threonine: Energy difference: 0.1272 kcal/mol, Difference in average score
from the base case: -0.1815 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 38 from chain A (isoleucine) into
methionine: Energy difference: -0.1794 kcal/mol, Difference in average
score from the base case: -0.0847 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 38 from chain A (isoleucine) into
leucine: Energy difference: -0.3589 kcal/mol, Difference in average score
from the base case: -0.0401 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 11 from chain A (isoleucine) into
threonine: Energy difference: 0.1989 kcal/mol, Difference in average score
from the base case: -0.1286 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 11 from chain A (isoleucine) into
methionine: Energy difference: 0.0833 kcal/mol, Difference in average score
from the base case: -0.0592 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 11 from chain A (isoleucine) into
leucine: Energy difference: -0.0349 kcal/mol, Difference in average score
from the base case: -0.0287 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 12 from chain A (leucine) into
methionine: Energy difference: 1.9306 kcal/mol, Difference in average score
from the base case: -0.0281 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 14 from chain A (isoleucine) into
threonine: Energy difference: 0.0965 kcal/mol, Difference in average score
from the base case: -0.1238 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 14 from chain A (isoleucine) into
methionine: Energy difference: 0.2096 kcal/mol, Difference in average score
from the base case: -0.0570 (00:01:30)
[INFO] AutoMutEv:Effect of mutation residue number 14 from chain A (isoleucine) into
leucine: Energy difference: 0.0858 kcal/mol, Difference in average score
from the base case: -0.0276 (00:01:30)
[INFO] Main: Simulation completed successfully. (00:01:32)
|
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan4D score | mutation |
|---|---|---|---|---|
| 1 | G | A | -0.8858 | |
| 2 | G | A | -1.0822 | |
| 3 | G | A | -0.9657 | |
| 4 | G | A | -0.5822 | |
| 5 | S | A | 0.3266 | |
| 6 | M | A | 1.7241 | |
| 7 | M | A | 1.9839 | |
| 8 | L | A | 1.5140 | |
| 9 | K | A | -0.4894 | |
| 10 | K | A | -0.9964 | |
| 11 | I | A | 1.5822 | |
| 12 | L | A | 1.4444 | |
| 13 | K | A | -0.0442 | |
| 14 | I | A | 0.7679 | |
| 15 | E | A | -1.7563 | |
| 16 | E | A | -2.1158 | |
| 17 | L | A | -1.1462 | |
| 18 | D | A | -2.7817 | |
| 19 | E | A | -3.6072 | |
| 20 | R | A | -3.2327 | |
| 21 | E | A | -1.9108 | |
| 22 | L | A | 0.7175 | |
| 23 | I | A | 1.9325 | |
| 24 | D | A | 0.3965 | |
| 25 | I | A | 0.3485 | |
| 26 | E | A | -1.4239 | |
| 27 | V | A | -0.6654 | |
| 28 | S | A | -0.8005 | |
| 29 | G | A | -1.2583 | |
| 30 | N | A | -1.4874 | |
| 31 | H | A | -1.1229 | |
| 32 | L | A | 0.2194 | |
| 33 | F | A | 1.0926 | |
| 34 | Y | A | 1.5304 | |
| 35 | A | A | 0.3532 | |
| 36 | N | A | -1.0813 | |
| 37 | D | A | -0.8792 | |
| 38 | I | A | 1.6009 | |
| 39 | L | A | 1.6910 | |
| 40 | T | A | 0.6903 | |
| 41 | H | A | -0.3567 | |
| 42 | N | A | 0.0000 | |
| 43 | S | A | -0.5400 | |
| 44 | A | A | -0.5639 | |
| 45 | S | A | -0.6477 |
Automated mutations analysis - evolutionary conserved mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated based off an evolutionary approach.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
| IM38A | -0.1794 | -0.0847 | View | CSV | PDB |
| IT23A | -0.0545 | -0.0854 | View | CSV | PDB |
| IM23A | -0.1302 | -0.0666 | View | CSV | PDB |
| IL38A | -0.3589 | -0.0401 | View | CSV | PDB |
| IL11A | -0.0349 | -0.0287 | View | CSV | PDB |
| IT14A | 0.0965 | -0.1238 | View | CSV | PDB |
| IM11A | 0.0833 | -0.0592 | View | CSV | PDB |
| IL14A | 0.0858 | -0.0276 | View | CSV | PDB |
| LM39A | 0.3587 | -0.0227 | View | CSV | PDB |
| LM12A | 1.9306 | -0.0281 | View | CSV | PDB |